Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP55487_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP55487_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ATP6V0D2 (ARP55487_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP6V0D2 (ARP55487_P050-HRP) antibody is Catalog # AAP55487 (Previous Catalog # AAPP33379)
Subunitd 2
ReferenceFridy,P.C., (2003) Biol. Cell 95 (7), 453-457
Publications

Okayasu, M. et al. Low-density lipoprotein receptor deficiency causes impaired osteoclastogenesis and increased bone mass in mice because of defect in osteoclastic cell-cell fusion. J. Biol. Chem. 287, 19229-41 (2012). WB, ICC/IF, Dog, Pig, Rabbit, Bovine, Rat, Mouse, Human, Horse, Guinea pig 22500026

Hamamura, K. et al. Predicting and validating the pathway of Wnt3a-driven suppression of osteoclastogenesis. Cell. Signal. 26, 2358-69 (2014). WB, Dog, Pig, Rabbit, Bovine, Rat, Mouse, Human, Horse, Guinea pig 25038457

Gene SymbolATP6V0D2
Gene Full NameATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Alias SymbolsVMA6, ATP6D2
NCBI Gene Id245972
Protein NameV-type proton ATPase subunit d 2
Description of TargetATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Uniprot IDQ8N8Y2
Protein Accession #NP_689778
Nucleotide Accession #NM_152565
Protein Size (# AA)350
Molecular Weight40kDa
Protein InteractionsAGO3; RBM15B; RPS3; NDUFB8; ADRM1;
  1. What is the species homology for "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    This target may also be called "VMA6, ATP6D2" in publications.

  5. What is the shipping cost for "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP6V0D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V0D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V0D2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V0D2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V0D2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V0D2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V0D2 Antibody - middle region : HRP (ARP55487_P050-HRP)
Your Rating
We found other products you might like!