Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP55487_P050-FITC Conjugated

ARP55487_P050-HRP Conjugated

ARP55487_P050-Biotin Conjugated

ATP6V0D2 Antibody - middle region (ARP55487_P050)

Catalog#: ARP55487_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-ATP6V0D2 (ARP55487_P050)
Peptide Sequence Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ATP6V0D2 (ARP55487_P050) antibody is Catalog # AAP55487 (Previous Catalog # AAPP33379)
Datasheets/Manuals Printable datasheet for anti-ATP6V0D2 (ARP55487_P050) antibody
Subunit d 2
Target Reference Fridy,P.C., (2003) Biol. Cell 95 (7), 453-457

Hamamura, K. et al. Predicting and validating the pathway of Wnt3a-driven suppression of osteoclastogenesis. Cell. Signal. 26, 2358-69 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25038457

Okayasu, M. et al. Low-density lipoprotein receptor deficiency causes impaired osteoclastogenesis and increased bone mass in mice because of defect in osteoclastic cell-cell fusion. J. Biol. Chem. 287, 19229-41 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22500026

Gene Symbol ATP6V0D2
Official Gene Full Name ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Alias Symbols ATP6D2, FLJ38708, VMA6
NCBI Gene Id 245972
Protein Name V-type proton ATPase subunit d 2
Description of Target ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Swissprot Id Q8N8Y2
Protein Accession # NP_689778
Nucleotide Accession # NM_152565
Protein Size (# AA) 350
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ATP6V0D2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ATP6V0D2.
Protein Interactions AGO3; RBM15B; RPS3; NDUFB8; ADRM1;
  1. What is the species homology for "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V0D2 Antibody - middle region (ARP55487_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    This target may also be called "ATP6D2, FLJ38708, VMA6" in publications.

  5. What is the shipping cost for "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V0D2 Antibody - middle region (ARP55487_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ATP6V0D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V0D2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V0D2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V0D2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V0D2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V0D2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V0D2 Antibody - middle region (ARP55487_P050)
Your Rating
We found other products you might like!