Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP55487_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP55487_P050-FITC Conjugated

ARP55487_P050-HRP Conjugated

ARP55487_P050-Biotin Conjugated

ATP6V0D2 Antibody - middle region (ARP55487_P050)

Catalog#: ARP55487_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-ATP6V0D2 (ARP55487_P050)
Peptide SequenceSynthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ATP6V0D2 (ARP55487_P050) antibody is Catalog # AAP55487 (Previous Catalog # AAPP33379)
Datasheets/ManualsPrintable datasheet for anti-ATP6V0D2 (ARP55487_P050) antibody
Subunitd 2
Target ReferenceFridy,P.C., (2003) Biol. Cell 95 (7), 453-457
Publications

Hamamura, K. et al. Predicting and validating the pathway of Wnt3a-driven suppression of osteoclastogenesis. Cell. Signal. 26, 2358-69 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25038457

Okayasu, M. et al. Low-density lipoprotein receptor deficiency causes impaired osteoclastogenesis and increased bone mass in mice because of defect in osteoclastic cell-cell fusion. J. Biol. Chem. 287, 19229-41 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22500026

Gene SymbolATP6V0D2
Official Gene Full NameATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Alias SymbolsATP6D2, FLJ38708, VMA6
NCBI Gene Id245972
Protein NameV-type proton ATPase subunit d 2
Description of TargetATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Swissprot IdQ8N8Y2
Protein Accession #NP_689778
Nucleotide Accession #NM_152565
Protein Size (# AA)350
Molecular Weight40kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ATP6V0D2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ATP6V0D2.
Protein InteractionsAGO3; RBM15B; RPS3; NDUFB8; ADRM1;
Write Your Own Review
You're reviewing:ATP6V0D2 Antibody - middle region (ARP55487_P050)
Your Rating
Aviva Live Chat
Assay Development
Aviva Travel Grant
Aviva Tips and Tricks