Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ATP6V0D2 Antibody - middle region (ARP55487_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55487_P050-FITC Conjugated

ARP55487_P050-HRP Conjugated

ARP55487_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
NCBI Gene Id:
Protein Name:
V-type proton ATPase subunit d 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ATP6D2, FLJ38708, VMA6
Description of Target:
ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATP6V0D2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATP6V0D2.
The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ATP6V0D2 (ARP55487_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ATP6V0D2 (ARP55487_P050) antibody is Catalog # AAP55487 (Previous Catalog # AAPP33379)
Printable datasheet for anti-ATP6V0D2 (ARP55487_P050) antibody
d 2
Target Reference:
Fridy,P.C., (2003) Biol. Cell 95 (7), 453-457

Hamamura, K. et al. Predicting and validating the pathway of Wnt3a-driven suppression of osteoclastogenesis. Cell. Signal. 26, 2358-69 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 25038457

Okayasu, M. et al. Low-density lipoprotein receptor deficiency causes impaired osteoclastogenesis and increased bone mass in mice because of defect in osteoclastic cell-cell fusion. J. Biol. Chem. 287, 19229-41 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22500026

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...