Catalog No: ARP45161_P050
Price: $0.00
SKU
ARP45161_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATP6V0C (ARP45161_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Pig: 79%; Rabbit: 86%; Rat: 90%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP6V0C (ARP45161_P050) antibody is Catalog # AAP45161 (Previous Catalog # AAPP26150)
Sample Type Confirmation

ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in ACHN, OVCAR3

Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolATP6V0C
Gene Full NameATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Alias SymbolsATPL, VATL, VPPC, Vma3, ATP6C, ATP6L
NCBI Gene Id527
Protein NameV-type proton ATPase 16 kDa proteolipid subunit
Description of TargetThis gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is part of the V0 domain. This gene had the previous symbols of ATP6C and ATP6L.
Uniprot IDP27449
Protein Accession #NP_001685
Nucleotide Accession #NM_001694
Protein Size (# AA)155
Molecular Weight16 kDa
Protein InteractionsSMIM3; UBC; PSMA3; MSR1; EDA; CERS2; CLIC1; RNF182; MARK3; ARF6;
  1. What is the species homology for "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP6V0C Antibody - middle region (ARP45161_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    This target may also be called "ATPL, VATL, VPPC, Vma3, ATP6C, ATP6L" in publications.

  5. What is the shipping cost for "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP6V0C Antibody - middle region (ARP45161_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP6V0C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP6V0C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP6V0C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP6V0C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP6V0C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP6V0C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP6V0C Antibody - middle region (ARP45161_P050)
Your Rating