Atp6v0a1 Antibody - C-terminal region (ARP37232_P050)

Catalog No: ARP37232_P050

Host: Rabbit
Target Name: Atp6v0a1
Sample Tissue: Human DLD1 Whole Cell
Antibody Dilution: 1ug/ml

WB Suggested Anti-Atp6v0a1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Uterus

Host: Rabbit
Target Name: Atp6v0a1
Sample Tissue: Mouse Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml

Sample Type:
A. untransfected HeLa cells B. mATP6V0A1 transfected HeLa cells
Primary Antibody Dilution:
1:250
Secondary Antibody:
Anti-rabbit AlexaFluor 488
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
Atp6v0a1: Green DAPI:Blue
Gene Name:
Atp6v0a1
Submitted by:
Anonymous

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Horse: 93%; Human: 86%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Atp6v0a1 (ARP37232_P050) antibody is Catalog # AAP37232 (Previous Catalog # AAPP20126)
• Subunit: a isoform 1
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Gene Symbol: Atp6v0a1
• Gene Full Name: ATPase, H+ transporting, lysosomal V0 subunit A1
• Alias Symbols: V, Vp, Atp, Vpp1, Vpp-1, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, AA959968, ARP37232
• NCBI Gene Id: 11975
• Protein Name: ATPase, H+ transporting, lysosomal V0 subunit A1, isoform CRA_j EMBL EDL03873.1
• Description of Target: Atp6v0a1 is required for assembly and activity of the vacuolar ATPase. Atp6v0a1 has a potential role in differential targeting and regulation of the enzyme for a specific organelle.
• Uniprot ID: A2A5A0
• Protein Accession #: NP_058616
• Nucleotide Accession #: NM_016920
• Protein Size (# AA): 838
• Molecular Weight: 96 kDa
• Protein Interactions: Eed; Atp6v1g1; Atp6v1g2; SNCA;