ATP6AP2 Recombinant Protein (Human ) (OPCA01478)

Catalog No: OPCA01478

ATP6AP2 Recombinant Protein (Human) (OPCA01478) in SDS-PAGE showing the molecular weight of approximately 53.43 kDa.

ATP6AP2 Recombinant Protein (Human) (OPCA01478) in SDS-PAGE showing the molecular weight of approximately 53.43 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Additional Information: Relevance: Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin syst (RAS).
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Protein Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 17-350 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Pivotal role of the renin/prorenin receptor in angiotensin II production and cellular responses to renin. Nguyen G., Delarue F., Burckle C., Bouzhir L., Giller T., Sraer J.-D. J. Clin. Invest. 109:1417-1427(2002)

Target Info

• Gene Symbol: ATP6AP2
• Gene Full Name: ATPase H+ transporting accessory protein 2
• Alias Symbols: APT6M8-9;ATP6IP2;ATP6M8-9;ATPase H(+)-transporting lysosomal accessory protein 2;ATPase H(+)-transporting lysosomal-interacting protein 2;ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9;ATPase, H+ transporting, lysosomal accessory protein 2;ATPase, H+ transporting, lysosomal interacting protein 2;CDG2R;ELDF10;embryonic liver differentiation factor 10;ER-localized type I transmembrane adapter;ER-localized type I transmembrane adaptor;HT028;M8-9;MRXE;MRXSH;MSTP009;N14F;prorenin receptor;PRR;renin receptor;renin/prorenin receptor;RENR;vacuolar ATP synthase membrane sector-associated protein M8-9;vacuolar proton ATP synthase membrane sector associated protein M8-9;V-ATPase M8.9 subunit;XMRE;XPDS.
• NCBI Gene Id: 10159
• Protein Name: Renin receptor
• Description of Target: Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
• Uniprot ID: O75787
• Protein Accession #: NP_005756.2
  
• Nucleotide Accession #: NM_005765.2
• Protein Size (# AA): Recombinant
• Molecular Weight: 41.5 kDa