ATP6AP1 Antibody - middle region (ARP45065_P050)

Catalog No: ARP45065_P050

WB Suggested Anti-ATP6AP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6AP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATP6AP1 (ARP45065_P050) antibody is Catalog # AAP45065 (Previous Catalog # AAPP12353)
• Subunit: S1

Target Info

• Gene Symbol: ATP6AP1
• Gene Full Name: ATPase, H+ transporting, lysosomal accessory protein 1
• Alias Symbols: 16A, CF2, Ac45, XAP3, XAP-3, ATP6S1, VATPS1, ATP6IP1
• NCBI Gene Id: 537
• Protein Name: V-type proton ATPase subunit S1
• Description of Target: This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kD and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.
• Uniprot ID: Q15904
• Protein Accession #: NP_001174
• Nucleotide Accession #: NM_001183
• Protein Size (# AA): 470
• Molecular Weight: 52
• Protein Interactions: K3; NR1I2; UBC; nef; HNRNPAB; ATP6V1C1; FBXO6; SYVN1; HBA2; ANG; HBA1;