Search Antibody, Protein, and ELISA Kit Solutions

ATP5PB Antibody - middle region (ARP48188_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48188_P050-FITC Conjugated

ARP48188_P050-HRP Conjugated

ARP48188_P050-Biotin Conjugated

Gene Symbol:
ATP5PB
NCBI Gene Id:
515
Official Gene Full Name:
ATP synthase peripheral stalk-membrane subunit b
Protein Name:
ATP synthase F(0) complex subunit B1, mitochondrial
Swissprot Id:
P24539
Protein Accession #:
NP_001679
Nucleotide Accession #:
NM_001688
Alias Symbols:
PIG47, ATP5F1
Replacement Item:
This antibody may replace item sc-162552 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
Protein Size (# AA):
256
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATP5PB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATP5PB.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ATP5F1
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ATP5F1 (ARP48188_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; ASB3; RNF2; vpu; CLIC1; NDUFS7; ATP6V1H; MRPL42; TOMM20; UQCRB; SDHA; RPS2; NDUFB9; NDUFB5; ATP5D; ATP5C1; CDK2; SPP1; ICT1; DSTYK;
Blocking Peptide:
For anti-ATP5PB (ARP48188_P050) antibody is Catalog # AAP48188 (Previous Catalog # AAPS22611)
Datasheets/Manuals:
Printable datasheet for anti-ATP5PB (ARP48188_P050) antibody
Sample Type Confirmation:

ATP5F1 is supported by BioGPS gene expression data to be expressed in 721_B, MCF7

Subunit:
b, mitochondrial
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Publications:

Perciavalle, R. M. et al. Anti-apoptotic MCL-1 localizes to the mitochondrial matrix and couples mitochondrial fusion to respiration. Nat. Cell Biol. 14, 575-83 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22544066

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...