SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48188_P050
Price: $0.00
SKU
ARP48188_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATP5PB (ARP48188_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ATP5F1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATP5PB (ARP48188_P050) antibody is Catalog # AAP48188 (Previous Catalog # AAPS22611)
Sample Type Confirmation

ATP5F1 is supported by BioGPS gene expression data to be expressed in 721_B, MCF7

Subunitb, mitochondrial
ReferenceEwing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Publications

Perciavalle, R. M. et al. Anti-apoptotic MCL-1 localizes to the mitochondrial matrix and couples mitochondrial fusion to respiration. Nat. Cell Biol. 14, 575-83 (2012). 22544066

Description
Gene SymbolATP5PB
Gene Full NameATP synthase peripheral stalk-membrane subunit b
Alias SymbolsPIG47, ATP5F1
NCBI Gene Id515
Protein NameATP synthase F(0) complex subunit B1, mitochondrial
Description of TargetThis gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
Uniprot IDP24539
Protein Accession #NP_001679
Nucleotide Accession #NM_001688
Protein Size (# AA)256
Molecular Weight25kDa
Protein InteractionsUBC; ASB3; RNF2; vpu; CLIC1; NDUFS7; ATP6V1H; MRPL42; TOMM20; UQCRB; SDHA; RPS2; NDUFB9; NDUFB5; ATP5D; ATP5C1; CDK2; SPP1; ICT1; DSTYK;
  1. What is the species homology for "ATP5PB Antibody - middle region (ARP48188_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ATP5PB Antibody - middle region (ARP48188_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATP5PB Antibody - middle region (ARP48188_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATP5PB Antibody - middle region (ARP48188_P050)"?

    This target may also be called "PIG47, ATP5F1" in publications.

  5. What is the shipping cost for "ATP5PB Antibody - middle region (ARP48188_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATP5PB Antibody - middle region (ARP48188_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATP5PB Antibody - middle region (ARP48188_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATP5PB Antibody - middle region (ARP48188_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP5PB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP5PB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP5PB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP5PB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP5PB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP5PB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATP5PB Antibody - middle region (ARP48188_P050)
Your Rating
We found other products you might like!