Search Antibody, Protein, and ELISA Kit Solutions

ATP5F1B Antibody - N-terminal region (ARP48185_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48185_T100-FITC Conjugated

ARP48185_T100-HRP Conjugated

ARP48185_T100-Biotin Conjugated

Gene Symbol:
ATP5F1B
NCBI Gene Id:
506
Official Gene Full Name:
ATP synthase F1 subunit beta
Protein Name:
ATP synthase subunit beta, mitochondrial
Swissprot Id:
P06576
Protein Accession #:
NP_001677
Nucleotide Accession #:
NM_001686
Alias Symbols:
ATP5B, ATPMB, ATPSB, HEL-S-271
Replacement Item:
This antibody may replace item sc-113533, HPA001520
Description of Target:
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
Protein Size (# AA):
529
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATP5F1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATP5F1B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B
Tested Species Reactivity:
Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-ATP5B (ARP48185_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT
Blocking Peptide:
For anti-ATP5F1B (ARP48185_T100) antibody is Catalog # AAP48185 (Previous Catalog # AAPP28694)
Datasheets/Manuals:
Printable datasheet for anti-ATP5F1B (ARP48185_T100) antibody
Subunit:
beta, mitochondrial
Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Vantourout,P., (2008) Mol. Immunol. 45 (2), 485-492
Publications:

Li, N., Bates, D. J., An, J., Terry, D. A. & Wang, E. Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain. Neurobiol. Aging 32, 944-55 (2011). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 19487051

Bannister, J. P. et al. Ca(V)1.2 channel N-terminal splice variants modulate functional surface expression in resistance size artery smooth muscle cells. J. Biol. Chem. 286, 15058-66 (2011). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 21364284

Guo, J. et al. Protein targets for carbonylation by 4-hydroxy-2-nonenal in rat liver mitochondria. J. Proteomics 74, 2370-9 (2011). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish 21801862

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...