ATP5F1B Antibody - N-terminal region (ARP48185_T100)

Catalog No: ARP48185_T100

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/mL of the antibody was used in this experiment.

Host: Rabbit
Target Name: ATP5B
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml

Host: Mouse
Target Name: ATP5B
Sample Tissue: Mouse Kidney
Antibody Dilution: 1ug/ml

ATP5B antibody - N-terminal region (ARP48185_T100) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

Human Muscle

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ATP5F1B (ARP48185_T100) antibody is Catalog # AAP48185 (Previous Catalog # AAPP28694)
• Subunit: beta, mitochondrial
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Vantourout,P., (2008) Mol. Immunol. 45 (2), 485-492
• Publications:

  A Chinese herbal formula, Jian-Pi-Yi-Shen decoction, improves muscle atrophy via regulating mitochondrial quality control process in 5/6 nephrectomised rats. Sci Rep. 7, 9253 (2017). 28835671

  Antioxidant Apigenin Relieves Age-Related Muscle Atrophy by Inhibiting Oxidative Stress and Hyperactive Mitophagy and Apoptosis in Skeletal Muscle of Mice. J Gerontol A Biol Sci Med Sci. 75, 2081-2088 (2020). 32857105

  Bannister, J. P. et al. Ca(V)1.2 channel N-terminal splice variants modulate functional surface expression in resistance size artery smooth muscle cells. J. Biol. Chem. 286, 15058-66 (2011). 21364284

  Guo, J. et al. Protein targets for carbonylation by 4-hydroxy-2-nonenal in rat liver mitochondria. J. Proteomics 74, 2370-9 (2011). 21801862

  Li, N., Bates, D. J., An, J., Terry, D. A. & Wang, E. Up-regulation of key microRNAs, and inverse down-regulation of their predicted oxidative phosphorylation target genes, during aging in mouse brain. Neurobiol. Aging 32, 944-55 (2011). 19487051

  Resveratrol Improves Muscle Atrophy by Modulating Mitochondrial Quality Control in STZ-Induced Diabetic Mice. Mol Nutr Food Res. 62, e1700941 (2018). 29578301

• Description:
  View product citations for ATP5F1B Antibody - N-terminal region (ARP48185_T100) on CiteAb

Target Info

• Gene Symbol: ATP5F1B
• Gene Full Name: ATP synthase F1 subunit beta
• Alias Symbols: ATP5B, ATPMB, ATPSB, HEL-S-271
• NCBI Gene Id: 506
• Protein Name: ATP synthase subunit beta, mitochondrial
• Description of Target: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
• Uniprot ID: P06576
• Protein Accession #: NP_001677
• Nucleotide Accession #: NM_001686
• Protein Size (# AA): 529
• Molecular Weight: 57 kDa
• Protein Interactions: FUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT