Search Antibody, Protein, and ELISA Kit Solutions

ATP5F1B Antibody - C-terminal region (ARP48186_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48186_T100-FITC Conjugated

ARP48186_T100-HRP Conjugated

ARP48186_T100-Biotin Conjugated

Gene Symbol:
ATP5F1B
Official Gene Full Name:
ATP synthase F1 subunit beta
NCBI Gene Id:
506
Protein Name:
ATP synthase subunit beta, mitochondrial
Swissprot Id:
P06576
Protein Accession #:
NP_001677
Nucleotide Accession #:
NM_001686
Alias Symbols:
ATP5B, ATPMB, ATPSB, HEL-S-271
Replacement Item:
This antibody may replace item sc-113533, HPA001520
Description of Target:
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
Protein Size (# AA):
529
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, IP, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATP5F1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATP5F1B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ATP5B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 79%
Complete computational species homology data:
Anti-ATP5B (ARP48186_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT
Blocking Peptide:
For anti-ATP5F1B (ARP48186_T100) antibody is Catalog # AAP48186 (Previous Catalog # AAPP28695)
Datasheets/Manuals:
Printable datasheet for anti-ATP5F1B (ARP48186_T100) antibody
Subunit:
beta, mitochondrial
Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Target Reference:
Vantourout,P., (2008) Mol. Immunol. 45 (2), 485-492
Publications:

Rubel, C. E. et al. Diggin’ on u(biquitin): a novel method for the identification of physiological E3 ubiquitin ligase substrates. Cell Biochem. Biophys. 67, 127-38 (2013). IHC, IP, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23695782

Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637-46 (2013). IHC, IP, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24041461

Usui, T. et al. Elevated mitochondrial biogenesis in skeletal muscle is associated with testosterone-induced body weight loss in male mice. FEBS Lett. 588, 1935-41 (2014). IHC, IP, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24726723

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...