Atp5f1 Antibody - N-terminal region (ARP48187_P050)

Catalog No: ARP48187_P050

WB Suggested Anti-Atp5f1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Heart

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Atp5f1 (ARP48187_P050) antibody is Catalog # AAPP28696
• Subunit: b, mitochondrial

Target Info

• Gene Symbol: Atp5f1
• Gene Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
• Alias Symbols: Atp5, Atp5f1, C76477
• NCBI Gene Id: 11950
• Protein Name: ATP synthase subunit b, mitochondrial
• Description of Target: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
• Uniprot ID: Q9CQQ7
• Protein Accession #: NP_033855
• Nucleotide Accession #: NM_009725
• Protein Size (# AA): 256
• Molecular Weight: 29kDa
• Protein Interactions: Plcb1; SNCA;