ATP4B Antibody - middle region (ARP44325_P050)

Catalog No: ARP44325_P050

WB Suggested Anti-ATP4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP4B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATP4B (ARP44325_P050) antibody is Catalog # AAP44325 (Previous Catalog # AAPS14509)
• Subunit: beta
• Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Target Info

• Gene Symbol: ATP4B
• Gene Full Name: ATPase, H+/K+ exchanging, beta polypeptide
• Alias Symbols: ATP6B
• NCBI Gene Id: 496
• Protein Name: Potassium-transporting ATPase subunit beta
• Description of Target: ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P51164
• Protein Accession #: NP_000696
• Nucleotide Accession #: NM_000705
• Protein Size (# AA): 291
• Molecular Weight: 33kDa
• Protein Interactions: CCNDBP1; ATP4A; AGO3; UBC; BPGM; STX1A;