ATP2C1 Antibody - C-terminal region (ARP44399_P050)

Catalog No: ARP44399_P050

WB Suggested Anti-ATP2C1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysateATP2C1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Rabbit Anti-ATP2C1 Antibody
Catalog Number: ARP44399_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic in golgi
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATP2C1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATP2C1 (ARP44399_P050) antibody is Catalog # AAP44399 (Previous Catalog # AAPP25710)
• Sample Type Confirmation:

  ATP2C1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Li,X.L., (2008) J Eur Acad Dermatol Venereol 22 (2), 253-254

Target Info

• Gene Symbol: ATP2C1
• Gene Full Name: ATPase, Ca++ transporting, type 2C, member 1
• Alias Symbols: HHD, BCPM, PMR1, SPCA1, hSPCA1, ATP2C1A
• NCBI Gene Id: 27032
• Protein Name: Calcium-transporting ATPase type 2C member 1
• Description of Target: ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: P98194
• Protein Accession #: NP_001001485
• Nucleotide Accession #: NM_001001485
• Protein Size (# AA): 888
• Molecular Weight: 98kDa
• Protein Interactions: UBC; RNF2; ELAVL1;