Atp1b2 Antibody - N-terminal region (ARP45156_P050)

Catalog No: ARP45156_P050

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.

WB Suggested Anti-Atp1b2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Kidney

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC, IHC-F
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Atp1b2 (ARP45156_P050) antibody is Catalog # AAP45156 (Previous Catalog # AAPP26145)
• Subunit: beta-2
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Publications:

  Li, Y.-G. et al. 1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice. Sci. Rep. 3, 1377 (2013). 23536174

  Li, Y.-G., Ji, D.-F., Zhong, S., Lv, Z.-Q. & Lin, T.-B. Cooperative anti-diabetic effects of deoxynojirimycin-polysaccharide by inhibiting glucose absorption and modulating glucose metabolism in streptozotocin-induced diabetic mice. PLoS One 8, e65892 (2013). 23755289

Target Info

• Gene Symbol: Atp1b2
• Gene Full Name: ATPase, Na+/K+ transporting, beta 2 polypeptide
• Alias Symbols: Am, Amog, Atpb, Atpb-2
• NCBI Gene Id: 11932
• Protein Name: Sodium/potassium-transporting ATPase subunit beta-2
• Description of Target: This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-2 subunit is not known.
• Uniprot ID: P14231
• Protein Accession #: NP_038201
• Nucleotide Accession #: NM_013415
• Protein Size (# AA): 290
• Molecular Weight: 33 kDa