Search Antibody, Protein, and ELISA Kit Solutions

Atp1b2 Antibody - N-terminal region (ARP45156_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45156_P050-FITC Conjugated

ARP45156_P050-HRP Conjugated

ARP45156_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
ATPase, Na+/K+ transporting, beta 2 polypeptide
NCBI Gene Id:
Protein Name:
Sodium/potassium-transporting ATPase subunit beta-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Amog, Atpb-2
Replacement Item:
This antibody may replace item sc-149789 from Santa Cruz Biotechnology.
Description of Target:
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-2 subunit is not known.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Atp1b2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Atp1b2.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-Atp1b2 (ARP45156_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Atp1b2 (ARP45156_P050) antibody is Catalog # AAP45156 (Previous Catalog # AAPP26145)
Printable datasheet for anti-Atp1b2 (ARP45156_P050) antibody

Li, Y.-G. et al. 1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice. Sci. Rep. 3, 1377 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23536174

Li, Y.-G., Ji, D.-F., Zhong, S., Lv, Z.-Q. & Lin, T.-B. Cooperative anti-diabetic effects of deoxynojirimycin-polysaccharide by inhibiting glucose absorption and modulating glucose metabolism in streptozotocin-induced diabetic mice. PLoS One 8, e65892 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23755289

Product Reviews

Average Rating:
2 reviews
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

269/09/2018 23:16
  • Quality:
  • Overall Experience:
Mouse Brain in IHC-Fr - PT.2

PART 2 - Submitted by: 

Alessio Stevano 

Università degli Studi del Piemonte Oriental

Show more comments (-2) Hide comments
269/09/2018 23:13
  • Quality:
  • Overall Experience:
Mouse Brain in IHC-Fr

Submitted by: 

Alessio Stevano 

Università degli Studi del Piemonte Orientale


“have stained very well and in a specific way”


1.       Sample type: Mouse brain tissue

2.       Primary antibody dilution: 1:200

3.       Secondary antibody dilution: biotinylated secondary - 1:200

4.       Fixation method: Frozen section fixation

5.       Protocol:

  • After having euthanized the mouse, extract the brain and immerge it in a 4% PFA solution for 24 hours at 4°.
  • After 24 hours, change the PFA with a 15% sucrose in PBS solution at 4°.
  • After 24 hours change the 15% sucrose solution with a 30% sucrose solution and leave it for 24 hours at 4°.
  • Cut the brain in a cryostat at 40 uM thickness.
  • Wash the sections 3 times in a TBST solution for 10 minutes each.
  • Mount the sections on a positive charged slide and leave it dry at room temperature for 3 hours.
  • Rehydrate the sections in ddH2o for 10 minutes at room temperature.
  • Pass the pap-pen (immunohistochemistry pen) around the sections without touching them.
  • Block endogenous peroxidases with a 0,3% H2O2 30% in TBS solution for 10 minutes.
  • Wash them 3 times in TBST for 10 minutes each.
  • Saturate with a 10% serum solution in TBST for 1 hour at 4° ( use the serum of the animal of 2° antibody)
  • Put the primary antibody in a 2% serum solution in TBST (we used a 1:200 diluition) O/N.
  • The day after, wash 3 times the slide in TBST 10 minutes each.
  • Use the secondary antibody (biotinilated in this case) in a TBS/2% serum solution (1:200) for 1h30 at 4°.
  • After one hour, mix solution A and B of the vector Lab ABC solution to enhance the DAB reaction.
  • Wash the sections 3 times in TBST 10 minutes each.
  • Add the ABC solution for 30 minutes at room temperature.
  • Wash slides 3 times in TBST 10 minutes each.
  • During the last wash prepare the DAB solution according to manufacturer's protocol.
  • Add the DAB on slides for 3 minutes.
  • Wash the slides 2 times in ddH2O to stop the reaction.
  • Mount the slides with proper mounting medium.
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...