Loading...
Catalog No: ARP45156_P050
Price: $0.00
SKU
ARP45156_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Atp1b2 (ARP45156_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC, IHC-F
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK
Concentration0.5 mg/ml
Blocking PeptideFor anti-Atp1b2 (ARP45156_P050) antibody is Catalog # AAP45156 (Previous Catalog # AAPP26145)
Subunitbeta-2
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Publications

Li, Y.-G. et al. 1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice. Sci. Rep. 3, 1377 (2013). 23536174

Li, Y.-G., Ji, D.-F., Zhong, S., Lv, Z.-Q. & Lin, T.-B. Cooperative anti-diabetic effects of deoxynojirimycin-polysaccharide by inhibiting glucose absorption and modulating glucose metabolism in streptozotocin-induced diabetic mice. PLoS One 8, e65892 (2013). 23755289

Gene SymbolAtp1b2
Gene Full NameATPase, Na+/K+ transporting, beta 2 polypeptide
Alias SymbolsAm, Amog, Atpb, Atpb-2
NCBI Gene Id11932
Protein NameSodium/potassium-transporting ATPase subunit beta-2
Description of TargetThis is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-2 subunit is not known.
Uniprot IDP14231
Protein Accession #NP_038201
Nucleotide Accession #NM_013415
Protein Size (# AA)290
Molecular Weight33 kDa
  1. What is the species homology for "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Atp1b2 Antibody - N-terminal region (ARP45156_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    This target may also be called "Am, Amog, Atpb, Atpb-2" in publications.

  5. What is the shipping cost for "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Atp1b2 Antibody - N-terminal region (ARP45156_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATP1B2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATP1B2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATP1B2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATP1B2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATP1B2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATP1B2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Atp1b2 Antibody - N-terminal region (ARP45156_P050)
Your Rating
We found other products you might like!