Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP45156_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45156_P050-FITC Conjugated

ARP45156_P050-HRP Conjugated

ARP45156_P050-Biotin Conjugated

Atp1b2 Antibody - N-terminal region (ARP45156_P050)

Rating:
80% of 100
Catalog#: ARP45156_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC, IHC-F
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-149789 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-Atp1b2 (ARP45156_P050)
Peptide SequenceSynthetic peptide located within the following region: WVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Atp1b2 (ARP45156_P050) antibody is Catalog # AAP45156 (Previous Catalog # AAPP26145)
Datasheets/ManualsPrintable datasheet for anti-Atp1b2 (ARP45156_P050) antibody
Subunitbeta-2
Publications

Li, Y.-G. et al. 1-deoxynojirimycin inhibits glucose absorption and accelerates glucose metabolism in streptozotocin-induced diabetic mice. Sci. Rep. 3, 1377 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23536174

Li, Y.-G., Ji, D.-F., Zhong, S., Lv, Z.-Q. & Lin, T.-B. Cooperative anti-diabetic effects of deoxynojirimycin-polysaccharide by inhibiting glucose absorption and modulating glucose metabolism in streptozotocin-induced diabetic mice. PLoS One 8, e65892 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23755289

Gene SymbolAtp1b2
Official Gene Full NameATPase, Na+/K+ transporting, beta 2 polypeptide
Alias SymbolsAmog, Atpb-2
NCBI Gene Id11932
Protein NameSodium/potassium-transporting ATPase subunit beta-2
Description of TargetThis is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-2 subunit is not known.
Swissprot IdP14231
Protein Accession #NP_038201
Nucleotide Accession #NM_013415
Protein Size (# AA)290
Molecular Weight33kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Atp1b2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Atp1b2.
Write Your Own Review
You're reviewing:Atp1b2 Antibody - N-terminal region (ARP45156_P050)
Your Rating
Aviva Pathways
Aviva Validation Data
Aviva Blast Tool
Aviva ChIP Antibodies