ATP1B1 Antibody - middle region (ARP44411_P050)

Catalog No: ARP44411_P050

WB Suggested Anti-ATP1B1 Antibody Titration: 0.25ug/ml
Positive Control: HepG2 cell lysateATP1B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Host: Rat
Target Name: ATP1B1
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml

Human Heart

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
  IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP1B1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 100%; Sheep: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATP1B1 (ARP44411_P050) antibody is Catalog # AAP44411 (Previous Catalog # AAPS15909)
• Sample Type Confirmation:

  ATP1B1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Subunit: beta-1
• Reference: Vagin,O., (2005) J. Biol. Chem. 280 (52), 43159-43167
• Publications:

  Dec1 and CLOCK Regulate Na+/K+-ATPase β1 Subunit Expression and Blood Pressure. Hypertension. 72, 746-754 (2018). 30012868

Target Info

• Gene Symbol: ATP1B1
• Gene Full Name: ATPase, Na+/K+ transporting, beta 1 polypeptide
• Alias Symbols: ATP1B
• NCBI Gene Id: 481
• Protein Name: Sodium/potassium-transporting ATPase subunit beta-1
• Description of Target: ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit.The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: P05026
• Protein Accession #: NP_001001787
• Nucleotide Accession #: NM_001001787
• Protein Size (# AA): 301
• Molecular Weight: 35kDa
• Protein Interactions: Bace1; EGFR; ATP4A; UBC; BRCA1; BARD1; PAXIP1; GCH1; USP4; NEDD4L; ELAVL1; NDRG2; TRMT2A; DDAH2; HLA-DRB1; HLA-DRA; EZH2; CRIP2; KMT2B; PSME1; HLA-DRB5; HLA-DRB4; HLA-DRB3; LRIF1; FXYD7; FXYD1;