ATP1A2 Antibody - N-terminal region (ARP96897_P050)

Catalog No: ARP96897_P050

Host: Rabbit
Target Name: ATP1A2
Sample Tissue: Human Du145 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATP1A2 (ARP96897_P050) antibody is Catalog # AAP96897

Target Info

• Gene Symbol: ATP1A2
• Gene Full Name: ATPase, Na+/K+ transporting, alpha 2 polypeptide
• Alias Symbols: FHM2, MHP2
• NCBI Gene Id: 477
• Protein Name: sodium/potassium-transporting ATPase subunit alpha-2
• Description of Target: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
• Uniprot ID: P50993
• Protein Accession #: NP_000693.1
• Nucleotide Accession #: NM_000702.3
• Protein Size (# AA): 1020
• Molecular Weight: 112 kDa