Search Antibody, Protein, and ELISA Kit Solutions

ATP1A2 Antibody - N-terminal region (ARP80440_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ATPase, Na+/K+ transporting, alpha 2 polypeptide
NCBI Gene Id:
Protein Name:
sodium/potassium-transporting ATPase subunit alpha-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
Protein Size (# AA):
Molecular Weight:
112 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATP1A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATP1A2.
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2
Peptide Sequence:
Synthetic peptide located within the following region: REYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ATP1A2 (ARP80440_P050) antibody is Catalog # AAP80440
Printable datasheet for anti-ATP1A2 (ARP80440_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...