ATP1A2 Antibody (ARP60207_P050)

Catalog No: ARP60207_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: ATP1A2
• Gene Full Name: ATPase, Na+/K+ transporting, alpha 2 polypeptide
• Alias Symbols: FHM2, MHP2
• NCBI Gene Id: 477
• Protein Name: Sodium/potassium-transporting ATPase subunit alpha-2
• Description of Target: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
• Uniprot ID: P50993
• Protein Accession #: NP_000693
• Nucleotide Accession #: NM_000702
• Protein Size (# AA): 1,020
• Molecular Weight: 112 kDa
• Protein Interactions: UBC; LGR4; ZNRF2; ZNRF1; CAND1; CUL3; FBXO25; TPT1;