- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
ATP1A2 Antibody (ARP60207_P050)
Datasheets/Manuals | Printable datasheet for anti-ATP1A2 (ARP60207_P050) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: ISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTY |
Concentration | 0.5 mg/ml |
Blocking Peptide | Available upon request |
Gene Symbol | ATP1A2 |
---|---|
Gene Full Name | ATPase, Na+/K+ transporting, alpha 2 polypeptide |
Alias Symbols | FHM2, MHP2 |
NCBI Gene Id | 477 |
Protein Name | Sodium/potassium-transporting ATPase subunit alpha-2 |
Description of Target | The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood. |
Uniprot ID | P50993 |
Protein Accession # | NP_000693 |
Nucleotide Accession # | NM_000702 |
Protein Size (# AA) | 1,020 |
Molecular Weight | 112 kDa |
Protein Interactions | UBC; LGR4; ZNRF2; ZNRF1; CAND1; CUL3; FBXO25; TPT1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ATP1A2 Antibody (ARP60207_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "ATP1A2 Antibody (ARP60207_P050)"?
This item is available "Domestic: within 1 week delivery | International: 1 week".
-
What buffer format is "ATP1A2 Antibody (ARP60207_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ATP1A2 Antibody (ARP60207_P050)"?
This target may also be called "FHM2, MHP2" in publications.
-
What is the shipping cost for "ATP1A2 Antibody (ARP60207_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ATP1A2 Antibody (ARP60207_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ATP1A2 Antibody (ARP60207_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "112 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ATP1A2 Antibody (ARP60207_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ATP1A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ATP1A2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ATP1A2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ATP1A2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ATP1A2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ATP1A2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.