Search Antibody, Protein, and ELISA Kit Solutions

ATG4A Antibody - N-terminal region (ARP42689_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42689_P050-FITC Conjugated

ARP42689_P050-HRP Conjugated

ARP42689_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ATG4A
Official Gene Full Name:
ATG4 autophagy related 4 homolog A (S. cerevisiae)
NCBI Gene Id:
115201
Protein Name:
Cysteine protease ATG4A
Swissprot Id:
Q8WYN0
Protein Accession #:
NP_443168
Nucleotide Accession #:
NM_052936
Alias Symbols:
APG4A, AUTL2
Replacement Item:
This antibody may replace item sc-131432 from Santa Cruz Biotechnology.
Description of Target:
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases.Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.
Protein Size (# AA):
398
Molecular Weight:
45kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATG4A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATG4A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ATG4A
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-ATG4A (ARP42689_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CDKL3; GABARAPL1; GABARAPL2; ATG101; MAP1LC3B;
Blocking Peptide:
For anti-ATG4A (ARP42689_P050) antibody is Catalog # AAP42689 (Previous Catalog # AAPP24921)
Datasheets/Manuals:
Printable datasheet for anti-ATG4A (ARP42689_P050) antibody
Target Reference:
Dunham,I., (2007) EMBO J. 26 (7), 1749-1760

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...