Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP42722_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42722_P050-FITC Conjugated

ARP42722_P050-HRP Conjugated

ARP42722_P050-Biotin Conjugated

ATG4A Antibody - middle region (ARP42722_P050)

Catalog#: ARP42722_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-131432 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ATG4A
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-ATG4A (ARP42722_P050)
Peptide Sequence Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ATG4A (ARP42722_P050) antibody is Catalog # AAP42722 (Previous Catalog # AAPP26434)
Datasheets/Manuals Printable datasheet for anti-ATG4A (ARP42722_P050) antibody
Publications

Bortnik, S; Choutka, C; Horlings, HM; Leung, S; Baker, JH; Lebovitz, C; Dragowska, WH; Go, NE; Bally, MB; Minchinton, AI; Gelmon, KA; Gorski, SM; Identification of breast cancer cell subtypes sensitive to ATG4B inhibition. 7, 66970-66988 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 27556700

Gene Symbol ATG4A
Official Gene Full Name ATG4 autophagy related 4 homolog A (S. cerevisiae)
Alias Symbols APG4A, AUTL2
NCBI Gene Id 115201
Protein Name Cysteine protease ATG4A
Description of Target Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases.
Swissprot Id Q8WYN0
Protein Accession # NP_443168
Nucleotide Accession # NM_052936
Protein Size (# AA) 398
Molecular Weight 45kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ATG4A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ATG4A.
Protein Interactions CDKL3; GABARAPL1; GABARAPL2; ATG101; MAP1LC3B;
Write Your Own Review
You're reviewing:ATG4A Antibody - middle region (ARP42722_P050)
Your Rating