Search Antibody, Protein, and ELISA Kit Solutions

ATG4A Antibody - middle region (ARP42722_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42722_P050-FITC Conjugated

ARP42722_P050-HRP Conjugated

ARP42722_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
ATG4 autophagy related 4 homolog A (S. cerevisiae)
NCBI Gene Id:
Protein Name:
Cysteine protease ATG4A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-131432 from Santa Cruz Biotechnology.
Description of Target:
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATG4A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATG4A.
The immunogen is a synthetic peptide directed towards the middle region of human ATG4A
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ATG4A (ARP42722_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ATG4A (ARP42722_P050) antibody is Catalog # AAP42722 (Previous Catalog # AAPP26434)
Printable datasheet for anti-ATG4A (ARP42722_P050) antibody

Bortnik, S; Choutka, C; Horlings, HM; Leung, S; Baker, JH; Lebovitz, C; Dragowska, WH; Go, NE; Bally, MB; Minchinton, AI; Gelmon, KA; Gorski, SM; Identification of breast cancer cell subtypes sensitive to ATG4B inhibition. 7, 66970-66988 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 27556700

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...