Search Antibody, Protein, and ELISA Kit Solutions

ATG3 Antibody - middle region (ARP54271_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54271_P050-FITC Conjugated

ARP54271_P050-HRP Conjugated

ARP54271_P050-Biotin Conjugated

Gene Symbol:
ATG3
Official Gene Full Name:
ATG3 autophagy related 3 homolog (S. cerevisiae)
NCBI Gene Id:
64422
Protein Name:
Ubiquitin-like-conjugating enzyme ATG3
Swissprot Id:
Q9NT62
Protein Accession #:
NP_071933
Nucleotide Accession #:
NM_022488
Alias Symbols:
APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96
Replacement Item:
This antibody may replace item sc-100508 from Santa Cruz Biotechnology.
Description of Target:
Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).
Protein Size (# AA):
314
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATG3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATG3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ATG3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 79%
Complete computational species homology data:
Anti-ATG3 (ARP54271_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; MAP1LC3B; UBC; SUMO1; NEDD8; ATG7; ATG5; ATG12; BECN1; HSPA9; DFFA; ASS1; NHLRC2; NANS; TNFAIP8; RPL23; BAG3; FNBP1L; GABARAPL1; MAP1LC3A; CFLAR; CREBBP; MAP1LC3C; ATG10; AMBRA1; ATG16L1; TECPR1; OBSL1; ATG4B; GABARAPL2; GABARAP; MAP1B; KRT85;
Blocking Peptide:
For anti-ATG3 (ARP54271_P050) antibody is Catalog # AAP54271 (Previous Catalog # AAPP44345)
Datasheets/Manuals:
Printable datasheet for anti-ATG3 (ARP54271_P050) antibody
Sample Type Confirmation:

ATG3 is supported by BioGPS gene expression data to be expressed in HEK293T

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...