Catalog No: ARP54268_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ATG16L1 Antibody - N-terminal region (ARP54268_P050)

Datasheets/ManualsPrintable datasheet for anti-ATG16L1 (ARP54268_P050) antibody
Product Info
ReferenceHancock,L., (er) Inflamm. Bowel Dis. (2008) In press
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATG16L1 (ARP54268_P050) antibody is Catalog # AAP54268 (Previous Catalog # AAPP31017)
Gene SymbolATG16L1
Gene Full NameATG16 autophagy related 16-like 1 (S. cerevisiae)
Alias SymbolsIBD10, WDR30, APG16L, ATG16A, ATG16L
NCBI Gene Id55054
Protein NameAutophagy-related protein 16-1
Description of TargetAutophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM].
Uniprot IDQ676U5
Protein Accession #NP_060444
Nucleotide Accession #NM_017974
Protein Size (# AA)588
Molecular Weight66kDa
  1. What is the species homology for "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATG16L1 Antibody - N-terminal region (ARP54268_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    This target may also be called "IBD10, WDR30, APG16L, ATG16A, ATG16L" in publications.

  5. What is the shipping cost for "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATG16L1 Antibody - N-terminal region (ARP54268_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATG16L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATG16L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATG16L1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATG16L1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATG16L1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATG16L1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATG16L1 Antibody - N-terminal region (ARP54268_P050)
Your Rating
We found other products you might like!