SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP64384_P050
Price: $0.00
SKU
ARP64384_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATG13 (ARP64384_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDW
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATG13 (ARP64384_P050) antibody is Catalog # AAP64384
Sample Type Confirmation

ATG13 is strongly supported by BioGPS gene expression data to be expressed in PANC1

Gene SymbolATG13
Gene Full NameATG13 autophagy related 13 homolog (S. cerevisiae)
Alias SymbolsKIAA0652, PARATARG8
NCBI Gene Id9776
Protein NameAutophagy-related protein 13
Description of TargetATG13 is an autophagy factor required for autophagosome formation. ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Uniprot IDO75143
Protein Accession #NP_001136145
Nucleotide Accession #NM_001142673
Protein Size (# AA)517
Molecular Weight56kDa
Protein InteractionsSESN2; ATG16L1; MAP1LC3A; ATG101; GABARAP; AMBRA1; ULK1; APP; MAP1LC3C; TAB3; MAP1LC3B; GABARAPL1; TAB2; GABARAPL2; UBC; RB1CC1;
  1. What is the species homology for "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATG13 Antibody - N-terminal region (ARP64384_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    This target may also be called "KIAA0652, PARATARG8" in publications.

  5. What is the shipping cost for "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATG13 Antibody - N-terminal region (ARP64384_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATG13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATG13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATG13"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATG13"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATG13"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATG13"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATG13 Antibody - N-terminal region (ARP64384_P050)
Your Rating
We found other products you might like!