Protein on Demand™ ATG12 Recombinant Protein (Mouse) (OPCA322439)

Catalog No: OPCA322439

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid
• Application: WB, ELISA
• Additional Information: For Research Use Only.
  Sterile filtering available upon request.
  Low endotoxin available upon request.
• Reconstitution and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
• Storage Buffer: Tris-based buffer,50% glycerol
• Protein Range: 1-141

Target Info

• Gene Full Name: autophagy related 12
• Alias Symbols: Apg12l, Atg12l, 4931423H11Rik, A330058M13Rik
• NCBI Gene Id: 67526
• Protein Name: ubiquitin-like protein ATG12
• Uniprot ID: Q9CQY1
• Protein Accession #: NP_080493.2
• Nucleotide Accession #: NM_026217.3
• Protein Size (# AA): 141