ATG12 Antibody - middle region (ARP54265_P050)

Catalog No: ARP54265_P050

WB Suggested Anti-ATG12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysateATG12 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Rabbit Anti-ATG12 Antibody
Catalog Number: ARP54265_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG12
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATG12 (ARP54265_P050) antibody is Catalog # AAP54265 (Previous Catalog # AAPP44344)
• Sample Type Confirmation:

  ATG12 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: ATG12
• Gene Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Alias Symbols: APG12, FBR93, APG12L, HAPG12
• NCBI Gene Id: 9140
• Protein Name: Ubiquitin-like protein ATG12
• Description of Target: Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).
• Uniprot ID: O94817
• Protein Accession #: NP_004698
• Nucleotide Accession #: NM_004707
• Protein Size (# AA): 187
• Molecular Weight: 21kDa
• Protein Interactions: CRX; WIPI2; FADD; EXOC4; Atg10; ATG3; ATG5; CAV1; ATG16L1; WDFY3; APP; BCL2; MCL1; TECPR1; UBC; ATG7; ATG4B; GABARAP; MAP1B; KRTAP4-12; PLSCR1; MDFI; PTK2; DHX36; OTUD4; SF3B1; SF3A1; AUP1;