ATF7 Antibody - N-terminal region : Biotin (P100817_P050-Biotin)

Catalog No: P100817_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATF7
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 84%; Human: 100%; Mouse: 78%; Pig: 100%; Rabbit: 100%; Rat: 84%
• Peptide Sequence: Synthetic peptide located within the following region: ASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATF7 (P100817_P050-Biotin) antibody is Catalog # AAP31164 (Previous Catalog # AAPP01907)
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: ATF7
• Gene Full Name: Activating transcription factor 7
• Alias Symbols: ATFA
• NCBI Gene Id: 11016
• Protein Name: Cyclic AMP-dependent transcription factor ATF-7
• Description of Target: The human ATF7(ATFa) proteins belong to the ATF/CREB family of transcription factors.They mediate the transcriptional activation by the largest E1a protein and can heterodimerize with members of the Jun/Fos family. ATFa proteins have also been found tightly associated with JNK2, a stress-activated kinase. Four variants of ATFa (ATFa0, ATFa1, ATFa2, and ATFa3) have been characterized.
• Uniprot ID: B2RMP1
• Protein Accession #: NP_006847
• Nucleotide Accession #: NM_006856
• Protein Size (# AA): 483
• Molecular Weight: 52kDa
• Protein Interactions: FCER2; TMEM239; FAM9B; CCDC155; MITD1; OCIAD1; TAOK3; URI1; MAPK8; UBC; CREB1; Cebpb; SUMO2; YY1; BCL6; TAF12; TAF4; MAPK9; PTP4A1; PTP4A2; FOS; ATF2; JDP2;