Search Antibody, Protein, and ELISA Kit Solutions

ATF6 Antibody - N-terminal region (ARP31688_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP31688_P050-FITC Conjugated

ARP31688_P050-HRP Conjugated

ARP31688_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-14250 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Rabbit: 92%; Rat: 79%
Complete computational species homology data:
Anti-ATF6 (ARP31688_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ATF6 (ARP31688_P050) antibody is Catalog # AAP31688 (Previous Catalog # AAPP02475)
Datasheets/Manuals:
Printable datasheet for anti-ATF6 (ARP31688_P050) antibody
Sample Type Confirmation:

ATF6 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Kerbiriou,M., Biochim. Biophys. Acta 1772 (11-12), 1236-1249 (2007)
Gene Symbol:
ATF6
Official Gene Full Name:
Activating transcription factor 6
Alias Symbols:
ATF6A
NCBI Gene Id:
22926
Protein Name:
Cyclic AMP-dependent transcription factor ATF-6 alpha
Description of Target:
ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-171 AB015856.1 2-172 172-265 BC014969.1 124-217 266-336 AB015856.1 267-337 337-650 BC014969.1 289-602 651-1294 AF005887.1 626-1269 1295-2406 AB015856.1 1296-2407 2407-2488 AF005887.1 2375-2456
Swissprot Id:
P18850
Protein Accession #:
NP_031374
Nucleotide Accession #:
NM_007348
Protein Size (# AA):
670
Molecular Weight:
74kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATF6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATF6.
Protein Interactions:
UBC; MAPK14; FBXO6; ATF6; XBP1; NNMT; DDC; BPGM; TNFRSF1A; APP; SP1; SUMO2; SYVN1; WFS1; SREBF2; YY1; NFYC; CREB1; CREB3L3; GTF2I; ATF6B; SRF; NFYA;

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

45/02/2019 16:51
  • Overall Experience:
  • Quality:
Pig lung in WB

Submitted by:
Tamas Dolinay
University of Pennsylvania Health System

ATF6

1. Sample type/lane description: Pig lung
Lane 1: 15ug pig lung (no ventilation)
Lane 2: 15ug pig lung (low tidal volume, 6ml/kg ventilation)
Lane 3: 15ug pig lung (high tidal volume, 12ml/kg ventilation)
Lane 4: 15ug pig lung (no ventilation)
Lane 5: 15ug pig lung (low tidal volume, 6ml/kg ventilation)
Lane 6: 15ug pig lung (high tidal volume, 12ml/kg ventilation)

2. Sample preparation methods:
Pig Lungs were ex vivo perfused with 1% albumin containing MEM media and ventilated with positive pressure mechanical ventilation for 4 hours. NV- no ventilation, LV- low tidal volume (6ml/kg) ventilation, HV- high tidal volume (12ml/kg) ventilation.

3. Primary antibody dilution: 1:1000

4. Secondary antibody and dilution: 1:2000 anti-rabbit secondary.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...