Atf6 Antibody - C-terminal region : FITC (ARP32293_P050-FITC)

Catalog No: ARP32293_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded mouse adipose tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Atf6 (ARP32293_P050-FITC) antibody is Catalog # AAP32293

Target Info

• Gene Symbol: Atf6
• Gene Full Name: Activating transcription factor 6
• Alias Symbols: ESTM4, ESTM49, AA789574, Atf6alpha, 9630036G24, 9130025P16Rik
• NCBI Gene Id: 226641
• Protein Name: Activating transcription factor 6 EMBL AAI41029.1
• Description of Target: The function of Atf6 remains unknown.
• Uniprot ID: B2RU98
• Protein Accession #: NP_001074773
• Nucleotide Accession #: NM_001081304
• Protein Size (# AA): 656
• Molecular Weight: 72kDa
• Protein Interactions: Hspa5;