ATF4 Antibody (Phospho-Ser245) (OAAF07681)

Catalog No: OAAF07681 (Formerly GWB-ASB609)

Size:100 ug

Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using ATF4 (Phospho-Ser245) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Liquid PBS containing 50% glycerol, 0.5% BSA, and 0.02% sodium azide
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S245
• Reconstitution and Storage: Store at -20°C for 1 year.
• Immunogen: The antiserum was produced against synthesized peptide derived from human ATF4 around the phosphorylation site of Ser245. AA range:212-261
• Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.
• Peptide Sequence: Synthetic peptide located within the following region: DTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPY
• Concentration: 1 mg/ml
• Specificity: Phospho-CREB-2 (S245) Polyclonal Antibody detects endogenous levels of CREB-2 protein only when phosphorylated at S245.
• Application Info: WB: 1:500~2000
  IHC: 1/100 - 1/300
  ELISA: 1/10000

Target Info

• Gene Symbol: ATF4
• Gene Full Name: activating transcription factor 4
• Alias Symbols: Activating transcription factor 4;cAMP response element-binding protein 2;cAMP-dependent transcription factor ATF-4;cAMP-responsive element-binding protein 2;CREB2;CREB-2;cyclic AMP-dependent transcription factor ATF-4;cyclic AMP-responsive element-binding protein 2;DNA-binding protein TAXREB67;TAXREB67;tax-responsive enhancer element B67;tax-responsive enhancer element-binding protein 67;TXREB.
• NCBI Gene Id: 468
• Protein Name: Cyclic AMP-dependent transcription factor ATF-4
• Description of Target: Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production (By similarity). It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to endoplasmic reticulum (ER) stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors (PubMed:26086088).
• Uniprot ID: P18848
• Molecular Weight: 38 kDa