Atf4 Antibody - N-terminal region (ARP38066_P050)

Catalog#: ARP38066_P050

• Size: 100 ul

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC-P
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-200 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066
• Publications:

  Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep 24793116

• Gene Symbol: Atf4
• Official Gene Full Name: Activating transcription factor 4
• Alias Symbols: Atf-4, C/ATF, CREB2, MGC96460, TAXREB67
• NCBI Gene Id: 11911
• Protein Name: Cyclic AMP-dependent transcription factor ATF-4
• Description of Target: The function of Atf4 remains unknown.
• Swissprot Id: Q5U4B2
• Protein Accession #: NP_033846
• Nucleotide Accession #: NM_009716
• Protein Size (# AA): 349
• Molecular Weight: 38kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express Atf4.
• Protein Interactions: Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Customer Reviews for Atf4 Antibody (ARP38066_P050) tested with mouse brain lysates in Western blot

Product Protocols: Atf4 antibody tested with Human Mouse Kidney Tissue (ARP38066_P050)