- Toll Free: (888)880-0001
- Phone: (858)552-6979
- Email: info@avivasysbio.com
- $40: Antibody & Protein in US
- $50: 1-2 Kits in US
- Contact us for international orders.
Conjugation Options
ARP38066_P050-FITC Conjugated
ARP38066_P050-HRP Conjugated
ARP38066_P050-Biotin Conjugated
Atf4 Antibody - N-terminal region (ARP38066_P050)
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC-P |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Replacement Item | This antibody may replace item sc-200 from Santa Cruz Biotechnology. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93% |
| Complete computational species homology data | Anti-Atf4 (ARP38066_P050) |
| Peptide Sequence | Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP |
| Concentration | Batch dependent within range: 100 ul at 0.5 - 1 mg/ml |
| Blocking Peptide | For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066 |
| Datasheets/Manuals | Printable datasheet for anti-Atf4 (ARP38066_P050) antibody |
| Publications | Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep 24793116 |
| Gene Symbol | Atf4 |
|---|---|
| Official Gene Full Name | Activating transcription factor 4 |
| Alias Symbols | Atf-4, C/ATF, CREB2, MGC96460, TAXREB67 |
| NCBI Gene Id | 11911 |
| Protein Name | Cyclic AMP-dependent transcription factor ATF-4 |
| Description of Target | The function of Atf4 remains unknown. |
| Swissprot Id | Q5U4B2 |
| Protein Accession # | NP_033846 |
| Nucleotide Accession # | NM_009716 |
| Protein Size (# AA) | 349 |
| Molecular Weight | 38kDa |
| Tissue Tool | Find tissues and cell lines supported by DNA array analysis to express Atf4.  |
| RNA Seq | Find tissues and cell lines supported by RNA-seq analysis to express Atf4.  |
| Protein Interactions | Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep".
-
How long will it take to receive "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "Atf4 Antibody - N-terminal region (ARP38066_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
This target may also be called "Atf-4, C/ATF, CREB2, MGC96460, TAXREB67" in publications.
-
What is the shipping cost for "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "38kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Atf4 Antibody - N-terminal region (ARP38066_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.
-
What are positive controls for "ATF4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ATF4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ATF4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ATF4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ATF4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ATF4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
