- Gene Symbol:
- Atf4
- NCBI Gene Id:
- 11911
- Official Gene Full Name:
- Activating transcription factor 4
- Protein Name:
- Cyclic AMP-dependent transcription factor ATF-4
- Swissprot Id:
- Q5U4B2
- Protein Accession #:
- NP_033846
- Nucleotide Accession #:
- NM_009716
- Alias Symbols:
- Atf-4, C/ATF, CREB2, MGC96460, TAXREB67
- Replacement Item:
- This antibody may replace item sc-200 from Santa Cruz Biotechnology.
- Description of Target:
- The function of Atf4 remains unknown.
- Protein Size (# AA):
- 349
- Molecular Weight:
- 38kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB, IHC-P
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express Atf4.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express Atf4.
- Immunogen:
- The immunogen is a synthetic peptide corresponding to a region of Mouse
- Tested Species Reactivity:
- Mouse
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
- Complete computational species homology data:
- Anti-Atf4 (ARP38066_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
- Blocking Peptide:
- For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066
- Datasheets/Manuals:
- Printable datasheet for anti-Atf4 (ARP38066_P050) antibody
- Publications:
Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep 24793116
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
