Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP38066_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38066_P050-FITC Conjugated

ARP38066_P050-HRP Conjugated

ARP38066_P050-Biotin Conjugated

More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC-P
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-200 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-Atf4 (ARP38066_P050)
Peptide Sequence Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066
Datasheets/Manuals Printable datasheet for anti-Atf4 (ARP38066_P050) antibody
Publications

Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep 24793116

Gene Symbol Atf4
Official Gene Full Name Activating transcription factor 4
Alias Symbols Atf-4, C/ATF, CREB2, MGC96460, TAXREB67
NCBI Gene Id 11911
Protein Name Cyclic AMP-dependent transcription factor ATF-4
Description of Target The function of Atf4 remains unknown.
Swissprot Id Q5U4B2
Protein Accession # NP_033846
Nucleotide Accession # NM_009716
Protein Size (# AA) 349
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Atf4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Atf4.
Protein Interactions Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
Write Your Own Review
You're reviewing:Atf4 Antibody - N-terminal region (ARP38066_P050)
Your Rating