Search Antibody, Protein, and ELISA Kit Solutions

Atf4 Antibody - N-terminal region (ARP38066_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38066_P050-FITC Conjugated

ARP38066_P050-HRP Conjugated

ARP38066_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-200 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-Atf4 (ARP38066_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Atf4 (ARP38066_P050) antibody is Catalog # AAP38066
Printable datasheet for anti-Atf4 (ARP38066_P050) antibody

Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep 24793116

Gene Symbol:
Official Gene Full Name:
Activating transcription factor 4
Alias Symbols:
Atf-4, C/ATF, CREB2, MGC96460, TAXREB67
NCBI Gene Id:
Protein Name:
Cyclic AMP-dependent transcription factor ATF-4
Description of Target:
The function of Atf4 remains unknown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Atf4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Atf4.
Protein Interactions:
Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...