Catalog No: ARP37017_P050
Price: $0.00
SKU
ARP37017_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ATF4 (ARP37017_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceMouse: 100%
Peptide SequenceSynthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATF4 (ARP37017_P050) antibody is Catalog # AAP37017 (Previous Catalog # AAPP09926)
ReferenceSmith,J.A., et al., (2006) J. Virol. 80 (4), 2019-2033
Publications

Alger, H. M., Rayavarapu, S. & Nagaraju, K. Measurement of activation of the endoplasmic reticulum stress response in autoimmune myositis. Methods Enzymol. 489, 207-25 (2011). 21266232

Cross-Talk Between FSH and Endoplasmic Reticulum Stress: A Mutually Suppressive Relationship. Reprod Sci. 23, 352-64 (2016). 26342052

Deficiency of VCP-Interacting Membrane Selenoprotein (VIMP) Leads to G1 Cell Cycle Arrest and Cell Death in MIN6 Insulinoma Cells. Cell Physiol Biochem. 51, 2185-2197 (2018). 30537728

Drivas, T. G., Holzbaur, E. L. F. & Bennett, J. Disruption of CEP290 microtubule/membrane-binding domains causes retinal degeneration. J. Clin. Invest. 123, 4525-39 (2013). 24051377

Glutathione S-Transferase P-Mediated Protein S-Glutathionylation of Resident Endoplasmic Reticulum Proteins Influences Sensitivity to Drug-Induced Unfolded Protein Response. Antioxid. Redox Signal. 26, 247-261 (2017). 26838680

IER3IP1 deficiency leads to increased β-cell death and decreased β-cell proliferation. Oncotarget. 8, 56768-56779 (2017). 28915629

Mast Cells Induce Blood Brain Barrier Damage in SCD by Causing Endoplasmic Reticulum Stress in the Endothelium. Front Cell Neurosci. 13, 56 (2019). 30837844

Methods for monitoring endoplasmic reticulum stress and the unfolded protein response. Int J Cell Biol. 2010, 830307 (2010). 20169136

Oligodendrocyte Death in Pelizaeus-Merzbacher Disease Is Rescued by Iron Chelation. Cell Stem Cell. 25, 531-541.e6 (2019). 31585094

Schneeberger, M. et al. Mitofusin 2 in POMC Neurons Connects ER Stress with Leptin Resistance and Energy Imbalance. Cell 155, 172-87 (2013). 24074867

The integrated stress response in hypoxia-induced diffuse white matter injury. J Neurosci. , (2017). 28720571

Gene SymbolATF4
Gene Full NameActivating transcription factor 4
Alias SymbolsAtf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67
NCBI Gene Id11911
Protein NameActivating transcriptionn factor 4 EMBL CAA43723.1
Description of TargetAtf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE's as a homodimer.
Uniprot IDQ61328
Protein Accession #NP_033846
Nucleotide Accession #NM_009716
Protein Size (# AA)381
Molecular Weight42kDa
Protein InteractionsEgln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
  1. What is the species homology for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATF4 Antibody - N-terminal region (ARP37017_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    This target may also be called "Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67" in publications.

  5. What is the shipping cost for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATF4 Antibody - N-terminal region (ARP37017_P050)
Your Rating
We found other products you might like!