ATF4 Antibody - N-terminal region (ARP37017_P050)

Catalog No: ARP37017_P050

WB Suggested Anti-ATF4 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:62500
Positive Control: NIH/3T3 cell lysate

Host: Rabbit
Target Name: ATF4
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Host: Mouse
Target Name: ATF4
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: Atf4
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 3ug/ml

Immunohistochemistry with Human Braun, cerebellum tissue at an antibody concentration of 5.0ug/ml using anti-ATF4 antibody (ARP37017_P050)

Rabbit Anti-ATF4 Antibody
Catalog Number: ARP37017_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue
Observed Staining: Cytoplasm, Nucleus
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ATF4 (ARP37017_P050) antibody is Catalog # AAP37017 (Previous Catalog # AAPP09926)
• Reference: Smith,J.A., et al., (2006) J. Virol. 80 (4), 2019-2033
• Publications:

  Alger, H. M., Rayavarapu, S. & Nagaraju, K. Measurement of activation of the endoplasmic reticulum stress response in autoimmune myositis. Methods Enzymol. 489, 207-25 (2011). 21266232

  Cross-Talk Between FSH and Endoplasmic Reticulum Stress: A Mutually Suppressive Relationship. Reprod Sci. 23, 352-64 (2016). 26342052

  Deficiency of VCP-Interacting Membrane Selenoprotein (VIMP) Leads to G1 Cell Cycle Arrest and Cell Death in MIN6 Insulinoma Cells. Cell Physiol Biochem. 51, 2185-2197 (2018). 30537728

  Drivas, T. G., Holzbaur, E. L. F. & Bennett, J. Disruption of CEP290 microtubule/membrane-binding domains causes retinal degeneration. J. Clin. Invest. 123, 4525-39 (2013). 24051377

  Glutathione S-Transferase P-Mediated Protein S-Glutathionylation of Resident Endoplasmic Reticulum Proteins Influences Sensitivity to Drug-Induced Unfolded Protein Response. Antioxid. Redox Signal. 26, 247-261 (2017). 26838680

  IER3IP1 deficiency leads to increased β-cell death and decreased β-cell proliferation. Oncotarget. 8, 56768-56779 (2017). 28915629

  Mast Cells Induce Blood Brain Barrier Damage in SCD by Causing Endoplasmic Reticulum Stress in the Endothelium. Front Cell Neurosci. 13, 56 (2019). 30837844

  Methods for monitoring endoplasmic reticulum stress and the unfolded protein response. Int J Cell Biol. 2010, 830307 (2010). 20169136

  Oligodendrocyte Death in Pelizaeus-Merzbacher Disease Is Rescued by Iron Chelation. Cell Stem Cell. 25, 531-541.e6 (2019). 31585094

  Schneeberger, M. et al. Mitofusin 2 in POMC Neurons Connects ER Stress with Leptin Resistance and Energy Imbalance. Cell 155, 172-87 (2013). 24074867

  The integrated stress response in hypoxia-induced diffuse white matter injury. J Neurosci. , (2017). 28720571

Target Info

• Gene Symbol: ATF4
• Gene Full Name: Activating transcription factor 4
• Alias Symbols: Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAXREB, TAXREB67
• NCBI Gene Id: 11911
• Protein Name: Activating transcriptionn factor 4 EMBL CAA43723.1
• Description of Target: Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE's as a homodimer.
• Uniprot ID: Q61328
• Protein Accession #: NP_033846
• Nucleotide Accession #: NM_009716
• Protein Size (# AA): 381
• Molecular Weight: 42kDa
• Protein Interactions: Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;