Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP37017_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37017_P050-FITC Conjugated

ARP37017_P050-HRP Conjugated

ARP37017_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-200 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Mouse: 100%
Complete computational species homology data Anti-ATF4 (ARP37017_P050)
Peptide Sequence Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ATF4 (ARP37017_P050) antibody is Catalog # AAP37017 (Previous Catalog # AAPP09926)
Datasheets/Manuals Printable datasheet for anti-ATF4 (ARP37017_P050) antibody
Target Reference Smith,J.A., et al., (2006) J. Virol. 80 (4), 2019-2033
Publications

Alger, H. M., Rayavarapu, S. & Nagaraju, K. Measurement of activation of the endoplasmic reticulum stress response in autoimmune myositis. Methods Enzymol. 489, 207-25 (2011). IHC, WB, Mouse 21266232

Drivas, T. G., Holzbaur, E. L. F. & Bennett, J. Disruption of CEP290 microtubule/membrane-binding domains causes retinal degeneration. J. Clin. Invest. 123, 4525-39 (2013). IHC, WB, Mouse 24051377

Schneeberger, M. et al. Mitofusin 2 in POMC Neurons Connects ER Stress with Leptin Resistance and Energy Imbalance. Cell 155, 172-87 (2013). IHC, WB, Mouse 24074867

Ye, ZW; Zhang, J; Ancrum, T; Manevich, Y; Townsend, DM; Tew, KD; Glutathione S-Transferase P-Mediated Protein S-Glutathionylation of Resident Endoplasmic Reticulum Proteins Influences Sensitivity to Drug-Induced Unfolded Protein Response. 26, 247-261 (2017). IHC, WB, Mouse 26838680

Gene Symbol ATF4
Official Gene Full Name Activating transcription factor 4
Alias Symbols Atf-4, C/ATF, CREB2, TAXREB67
NCBI Gene Id 11911
Protein Name Activating transcriptionn factor 4 EMBL CAA43723.1
Description of Target Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE's as a homodimer.
Swissprot Id Q61328
Protein Accession # NP_033846
Nucleotide Accession # NM_009716
Protein Size (# AA) 381
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ATF4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ATF4.
Protein Interactions Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
  1. What is the species homology for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATF4 Antibody - N-terminal region (ARP37017_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    This target may also be called "Atf-4, C/ATF, CREB2, TAXREB67" in publications.

  5. What is the shipping cost for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATF4 Antibody - N-terminal region (ARP37017_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ATF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATF4 Antibody - N-terminal region (ARP37017_P050)
Your Rating
We found other products you might like!