Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ATF4 Antibody - N-terminal region (ARP37017_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37017_P050-FITC Conjugated

ARP37017_P050-HRP Conjugated

ARP37017_P050-Biotin Conjugated

Gene Symbol:
ATF4
Official Gene Full Name:
Activating transcription factor 4
NCBI Gene Id:
11911
Protein Name:
Activating transcriptionn factor 4 EMBL CAA43723.1
Swissprot Id:
Q61328
Protein Accession #:
NP_033846
Nucleotide Accession #:
NM_009716
Alias Symbols:
Atf-4, C/ATF, CREB2, TAXREB67
Replacement Item:
This antibody may replace item sc-200 from Santa Cruz Biotechnology.
Description of Target:
Atf4 binds to asymmetric cAMP response elements (CRE) as a heterodimer and to palindromic CRE's as a homodimer.
Protein Size (# AA):
381
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATF4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATF4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%
Complete computational species homology data:
Anti-ATF4 (ARP37017_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
Blocking Peptide:
For anti-ATF4 (ARP37017_P050) antibody is Catalog # AAP37017 (Previous Catalog # AAPP09926)
Datasheets/Manuals:
Printable datasheet for anti-ATF4 (ARP37017_P050) antibody
Target Reference:
Smith,J.A., et al., (2006) J. Virol. 80 (4), 2019-2033
Publications:

Alger, H. M., Rayavarapu, S. & Nagaraju, K. Measurement of activation of the endoplasmic reticulum stress response in autoimmune myositis. Methods Enzymol. 489, 207-25 (2011). IHC, WB, Mouse 21266232

Drivas, T. G., Holzbaur, E. L. F. & Bennett, J. Disruption of CEP290 microtubule/membrane-binding domains causes retinal degeneration. J. Clin. Invest. 123, 4525-39 (2013). IHC, WB, Mouse 24051377

Schneeberger, M. et al. Mitofusin 2 in POMC Neurons Connects ER Stress with Leptin Resistance and Energy Imbalance. Cell 155, 172-87 (2013). IHC, WB, Mouse 24074867

Ye, ZW; Zhang, J; Ancrum, T; Manevich, Y; Townsend, DM; Tew, KD; Glutathione S-Transferase P-Mediated Protein S-Glutathionylation of Resident Endoplasmic Reticulum Proteins Influences Sensitivity to Drug-Induced Unfolded Protein Response. 26, 247-261 (2017). IHC, WB, Mouse 26838680

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...