Search Antibody, Protein, and ELISA Kit Solutions

ASZ1 Antibody - middle region (ARP52537_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52537_P050-FITC Conjugated

ARP52537_P050-HRP Conjugated

ARP52537_P050-Biotin Conjugated

Gene Symbol:
ASZ1
Official Gene Full Name:
Ankyrin repeat, SAM and basic leucine zipper domain containing 1
NCBI Gene Id:
136991
Protein Name:
Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
Swissprot Id:
Q8WWH4
Protein Accession #:
NP_570124
Nucleotide Accession #:
NM_130768
Alias Symbols:
ALP1, ANKL1, C7orf7, GASZ, MGC26634, Orf3, CT1.19
Replacement Item:
This antibody may replace item sc-72573 from Santa Cruz Biotechnology.
Description of Target:
ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.ASZ1 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process.ASZ1 is required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons.ASZ1 may act by mediating protein-protein interactions during germ cell maturation.
Protein Size (# AA):
475
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASZ1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASZ1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ASZ1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-ASZ1 (ARP52537_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TSG101;
Blocking Peptide:
For anti-ASZ1 (ARP52537_P050) antibody is Catalog # AAP52537 (Previous Catalog # AAPP42844)
Datasheets/Manuals:
Printable datasheet for anti-ASZ1 (ARP52537_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...