Size:100 ul
$229.00
In Stock
SKU
ARP41367_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41367_T100-FITC Conjugated

ARP41367_T100-HRP Conjugated

ARP41367_T100-Biotin Conjugated

ASS Antibody - C-terminal region (ARP41367_T100)

Catalog#: ARP41367_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-365475, HPA020896, HPA020934
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ASS
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-ASS (ARP41367_T100)
Peptide SequenceSynthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ASS1 (ARP41367_T100) antibody is Catalog # AAP41367 (Previous Catalog # AAPP24106)
Datasheets/ManualsPrintable datasheet for anti-ASS1 (ARP41367_T100) antibody
Target ReferenceHao,G., (2004) J. Biol. Chem. 279 (35), 36192-36200
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24465277

Gene SymbolASS1
Official Gene Full NameArgininosuccinate synthase 1
Alias SymbolsASS1, CTLN1, DKFZp434P0216, ASS
NCBI Gene Id445
Protein NameArgininosuccinate synthase
Description of TargetASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
Swissprot IdP00966
Protein Accession #NP_446464
Nucleotide Accession #NM_054012
Protein Size (# AA)412
Molecular Weight45kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ASS.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ASS.
Protein InteractionsASS1; UBC; ASB18; ASB9; NHLRC2; ATG3; CNDP2; NANS; TNFAIP8; NAMPT; DPP3; RPL23; CTSA; PEPD; MVD; HSPA9; GSS; GBP2; EIF4E; DLD; CAPN1; FBXO6; LATS1; MT2A; MLH1; JAK2; PTPN1; GIT2; SPR; APP; USP4; TERF2; TERF1; SUMO2; AI837181; MYC; ASCC2; AKTIP; ARAF; ELN;
Write Your Own Review
You're reviewing:ASS Antibody - C-terminal region (ARP41367_T100)
Your Rating
Aviva Validation Data
Assay Development
Aviva HIS tag Deal
Free Microscope