Search Antibody, Protein, and ELISA Kit Solutions

ASS antibody - C-terminal region (ARP41367_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41367_T100-FITC Conjugated

ARP41367_T100-HRP Conjugated

ARP41367_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Argininosuccinate synthase 1
Protein Name:
Argininosuccinate synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ASS1, CTLN1, DKFZp434P0216, ASS
Replacement Item:
This antibody may replace item sc-365475, HPA020896, HPA020934
Description of Target:
ASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASS.
The immunogen is a synthetic peptide directed towards the C terminal region of human ASS
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-ASS (ARP41367_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ASS1 (ARP41367_T100) antibody is Catalog # AAP41367 (Previous Catalog # AAPP24106)
Printable datasheet for anti-ASS1 (ARP41367_T100) antibody
Target Reference:
Hao,G., (2004) J. Biol. Chem. 279 (35), 36192-36200

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...