Search Antibody, Protein, and ELISA Kit Solutions

ASS Antibody - C-terminal region (ARP41367_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41367_T100-FITC Conjugated

ARP41367_T100-HRP Conjugated

ARP41367_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-365475, HPA020896, HPA020934
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ASS
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Goat: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-ASS (ARP41367_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ASS1 (ARP41367_T100) antibody is Catalog # AAP41367 (Previous Catalog # AAPP24106)
Datasheets/Manuals:
Printable datasheet for anti-ASS1 (ARP41367_T100) antibody
Target Reference:
Hao,G., (2004) J. Biol. Chem. 279 (35), 36192-36200
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24465277

Gene Symbol:
ASS1
Official Gene Full Name:
Argininosuccinate synthase 1
Alias Symbols:
ASS1, CTLN1, DKFZp434P0216, ASS
NCBI Gene Id:
445
Protein Name:
Argininosuccinate synthase
Description of Target:
ASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of ASS cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
Swissprot Id:
P00966
Protein Accession #:
NP_446464
Nucleotide Accession #:
NM_054012
Protein Size (# AA):
412
Molecular Weight:
45kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASS.
Protein Interactions:
ASS1; UBC; ASB18; ASB9; NHLRC2; ATG3; CNDP2; NANS; TNFAIP8; NAMPT; DPP3; RPL23; CTSA; PEPD; MVD; HSPA9; GSS; GBP2; EIF4E; DLD; CAPN1; FBXO6; LATS1; MT2A; MLH1; JAK2; PTPN1; GIT2; SPR; APP; USP4; TERF2; TERF1; SUMO2; AI837181; MYC; ASCC2; AKTIP; ARAF; ELN;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...