Size:100 ul
$229.00
In stock
SKU
ARP41667_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41667_T100-FITC Conjugated

ARP41667_T100-HRP Conjugated

ARP41667_T100-Biotin Conjugated

ASL Antibody - middle region (ARP41667_T100)

Rating:
80% of 100
Catalog#: ARP41667_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166787 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASL
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Complete computational species homology data Anti-ASL (ARP41667_T100)
Peptide Sequence Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ASL (ARP41667_T100) antibody is Catalog # AAP41667 (Previous Catalog # AAPP24311)
Datasheets/Manuals Printable datasheet for anti-ASL (ARP41667_T100) antibody
Target Reference Tanaka,T., (2002) Tohoku J. Exp. Med. 198 (2), 119-124
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24465277

Gene Symbol ASL
Official Gene Full Name Argininosuccinate lyase
Alias Symbols ASAL
NCBI Gene Id 435
Protein Name Argininosuccinate lyase
Description of Target ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
Swissprot Id P04424
Protein Accession # NP_001020115
Nucleotide Accession # NM_001024944
Protein Size (# AA) 444
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ASL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ASL.
Protein Interactions WDYHV1; ASL; GINS4; NCDN; TUFM; PDHA1; NEDD8; HK1; GDI1; BAG3; OVGP1; HMOX1; FBP1; CSNK2A2; UBC; QARS;
Write Your Own Review
You're reviewing:ASL Antibody - middle region (ARP41667_T100)
Your Rating