Search Antibody, Protein, and ELISA Kit Solutions

ASGR1 Antibody - middle region (ARP33805_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33805_P050-FITC Conjugated

ARP33805_P050-HRP Conjugated

ARP33805_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Asialoglycoprotein receptor 1
NCBI Gene Id:
Protein Name:
Asialoglycoprotein receptor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ASGPR, CLEC4H1, Hs.12056, HL-1, ASGPR1
Description of Target:
ASGR1 is a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASGR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASGR1.
The immunogen is a synthetic peptide directed towards the middle region of Human ASGR1
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 91%; Pig: 93%; Rat: 92%; Yeast: 75%
Complete computational species homology data:
Anti-ASGR1 (ARP33805_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ASGR1 (ARP33805_P050) antibody is Catalog # AAP33805
Printable datasheet for anti-ASGR1 (ARP33805_P050) antibody
Sample Type Confirmation:

ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2


Chang, T.-C. et al. Synthesis and evaluation of a photoactive probe with a multivalent carbohydrate for capturing carbohydrate-lectin interactions. Bioconjug. Chem. 24, 1895-906 (2013). WB, Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast 24151840

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...