Catalog No: AVARP00017_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ASCL1 (AVARP00017_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ASCL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW
Concentration0.5 mg/ml
Blocking PeptideFor anti-ASCL1 (AVARP00017_P050) antibody is Catalog # AAP30431 (Previous Catalog # AAPP01014)
Sample Type Confirmation

ASCL1 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

ReferenceOsada,H., (2008) Cancer Res. 68 (6), 1647-1655
Gene SymbolASCL1
Gene Full NameAchaete-scute complex homolog 1 (Drosophila)
Alias SymbolsASH1, HASH1, MASH1, bHLHa46
NCBI Gene Id429
Protein NameAchaete-scute homolog 1
Description of TargetASCL1 may play a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. ASCL1 is essential for the generation of olfactory and autonomic neurons. ASCL1 activates transcription by binding to the E box (5'-CANNTG-3').This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP50553
Protein Accession #NP_004307
Nucleotide Accession #NM_004316
Protein Size (# AA)236
Molecular Weight25kDa
Protein InteractionsMEF2D; MEF2C; MEF2A; NEUROG2; UBQLN1; EP300; TCF4; BMP2; ASCL1;
  1. What is the species homology for "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig".

  2. How long will it take to receive "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ASCL1 Antibody - middle region (AVARP00017_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    This target may also be called "ASH1, HASH1, MASH1, bHLHa46" in publications.

  5. What is the shipping cost for "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ASCL1 Antibody - middle region (AVARP00017_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ASCL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ASCL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ASCL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ASCL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ASCL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ASCL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ASCL1 Antibody - middle region (AVARP00017_P050)
Your Rating
We found other products you might like!