ASB4 Antibody - middle region (ARP62054_P050)

Catalog No: ARP62054_P050

WB Suggested Anti-ASB4 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Yeast: 75%
• Peptide Sequence: Synthetic peptide located within the following region: VAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ASB4 (ARP62054_P050) antibody is Catalog # AAP62054

Target Info

• Gene Symbol: ASB4
• Gene Full Name: Ankyrin repeat and SOCS box containing 4
• Alias Symbols: ASB-4
• NCBI Gene Id: 51666
• Protein Name: Ankyrin repeat and SOCS box protein 4
• Description of Target: The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but some of the full length sequences are not known.
• Uniprot ID: Q9Y574
• Protein Accession #: NP_057200
• Nucleotide Accession #: NM_016116
• Protein Size (# AA): 426
• Molecular Weight: 47kDa
• Protein Interactions: UBE2D1; ID2; TUBB8; ASB7; RPS27L; HSPB8; DNAJB5; DNAJB4; TUBB4A; TUBB3; STUB1; RNF7; CUL4A; CUL5; TUBB2A; TFRC; HSPD1; HSPB1; FARSA; DDB1; HSP90AA1; Gps1; HIF1AN; CUL2; TCEB2; RIT1;