SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP67378_P050
Price: $0.00
SKU
ARP67378_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ASB14 (ARP67378_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ASB14
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LELLIQAGFDVNFMLDQRINKHYDDHRKSALYFAVSNSDLSSVKLLLSAG
Concentration0.5 mg/ml
Blocking PeptideFor anti-ASB14 (ARP67378_P050) antibody is Catalog # AAP67378
Gene SymbolASB14
Alias SymbolsDKFZp313L0121
NCBI Gene Id142686
Protein NameAnkyrin repeat and SOCS box protein 14
Description of TargetThe protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Uniprot IDA6NK59
Protein Accession #NP_569058
Nucleotide Accession #NM_130387
Protein Size (# AA)302
Molecular Weight33kDa
Protein InteractionsPGAM5; PHB2; RPL23; VAPA; CUL5; VDAC1; TUFM; TCEB2; TCEB1; SSR4; SLC25A1; RPS16; NOTCH2; GALK1; EMD; CYC1; ATP2A2; ARF4; SLC25A6; SLC25A5;
  1. What is the species homology for "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ASB14 Antibody - N-terminal region (ARP67378_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    This target may also be called "DKFZp313L0121" in publications.

  5. What is the shipping cost for "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ASB14 Antibody - N-terminal region (ARP67378_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ASB14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ASB14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ASB14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ASB14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ASB14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ASB14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ASB14 Antibody - N-terminal region (ARP67378_P050)
Your Rating