Artemis Antibody (OAAF07862)

Catalog No: OAAF07862 (Formerly GWB-ASC162)

Size:100 ug

Immunohistochemistry analysis of paraffin-embedded human lung carcinoma tissue, using Artemis Antibody. The picture on the right is blocked with the synthesized peptide.

Immunofluorescence analysis of NIH/3T3 cells, using Artemis Antibody. The picture on the right is blocked with the synthesized peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human Artemis.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
• Peptide Sequence: Synthetic peptide located within the following region: ADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTH
• Concentration: 1mg/ml
• Specificity: Artemis Antibody detects endogenous levels of total Artemis protein.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info:
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:10000

Target Info

• Gene Symbol: DCLRE1C
• Gene Full Name: DNA cross-link repair 1C
• Alias Symbols: A-SCID;DCLREC1C;DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae);DNA cross-link repair 1C protein;protein artemis;Protein A-SCID;RS-SCID;SCIDA;severe combined immunodeficiency, type a (Athabascan);SNM1 homolog C;SNM1C;SNM1-like protein.
• NCBI Gene Id: 64421
• Protein Name: Protein artemis
• Description of Target: Required for V(D)J recombination, the process by which exons encoding the antigen-binding domains of immunoglobulins and T-cell receptor proteins are assembled from individual V, (D), and J gene segments. V(D)J recombination is initiated by the lymphoid specific RAG endonuclease complex, which generates site specific DNA double strand breaks (DSBs). These DSBs present two types of DNA end structures: hairpin sealed coding ends and phosphorylated blunt signal ends. These ends are independently repaired by the non homologous end joining (NHEJ) pathway to form coding and signal joints respectively. This protein exhibits single-strand specific 5'-3' exonuclease activity in isolation and acquires endonucleolytic activity on 5' and 3' hairpins and overhangs when in a complex with PRKDC. The latter activity is required specifically for the resolution of closed hairpins prior to the formation of the coding joint. May also be required for the repair of complex DSBs induced by ionizing radiation, which require substantial end-processing prior to religation by NHEJ.
• Uniprot ID: Q96SD1
• Molecular Weight: 78 kDa