- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for Artemis Antibody (OAAF07862) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human Artemis. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
Peptide Sequence | Synthetic peptide located within the following region: ADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTH |
Concentration | 1mg/ml |
Specificity | Artemis Antibody detects endogenous levels of total Artemis protein. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:10000 |
Gene Symbol | DCLRE1C |
---|---|
Gene Full Name | DNA cross-link repair 1C |
Alias Symbols | A-SCID;DCLREC1C;DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae);DNA cross-link repair 1C protein;protein artemis;Protein A-SCID;RS-SCID;SCIDA;severe combined immunodeficiency, type a (Athabascan);SNM1 homolog C;SNM1C;SNM1-like protein. |
NCBI Gene Id | 64421 |
Protein Name | Protein artemis |
Description of Target | Required for V(D)J recombination, the process by which exons encoding the antigen-binding domains of immunoglobulins and T-cell receptor proteins are assembled from individual V, (D), and J gene segments. V(D)J recombination is initiated by the lymphoid specific RAG endonuclease complex, which generates site specific DNA double strand breaks (DSBs). These DSBs present two types of DNA end structures: hairpin sealed coding ends and phosphorylated blunt signal ends. These ends are independently repaired by the non homologous end joining (NHEJ) pathway to form coding and signal joints respectively. This protein exhibits single-strand specific 5'-3' exonuclease activity in isolation and acquires endonucleolytic activity on 5' and 3' hairpins and overhangs when in a complex with PRKDC. The latter activity is required specifically for the resolution of closed hairpins prior to the formation of the coding joint. May also be required for the repair of complex DSBs induced by ionizing radiation, which require substantial end-processing prior to religation by NHEJ. |
Uniprot ID | Q96SD1 |
Molecular Weight | 78 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Artemis Antibody (OAAF07862)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Artemis Antibody (OAAF07862)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Artemis Antibody (OAAF07862)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Artemis Antibody (OAAF07862)"?
This target may also be called "A-SCID;DCLREC1C;DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae);DNA cross-link repair 1C protein;protein artemis;Protein A-SCID;RS-SCID;SCIDA;severe combined immunodeficiency, type a (Athabascan);SNM1 homolog C;SNM1C;SNM1-like protein." in publications.
-
What is the shipping cost for "Artemis Antibody (OAAF07862)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Artemis Antibody (OAAF07862)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Artemis Antibody (OAAF07862)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "78 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Artemis Antibody (OAAF07862)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DCLRE1C"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DCLRE1C"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DCLRE1C"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DCLRE1C"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DCLRE1C"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DCLRE1C"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.