Search Antibody, Protein, and ELISA Kit Solutions

ARPC3 Antibody - N-terminal region (ARP52092_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP52092_P050-FITC Conjugated

ARP52092_P050-HRP Conjugated

ARP52092_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ARPC3
Official Gene Full Name:
actin related protein 2/3 complex subunit 3
NCBI Gene Id:
10094
Protein Name:
actin-related protein 2/3 complex subunit 3
Swissprot Id:
O15145
Protein Accession #:
NP_005710
Nucleotide Accession #:
NM_005719
Alias Symbols:
ARC21, p21-Arc
Replacement Item:
This antibody may replace item sc-136020 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
178
Molecular Weight:
20kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARPC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARPC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC3
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-ARPC3 (ARP52092_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; HOXA3; GOLGA2; WASL; NRIP1; PRKAR1A; TRMT10A; ARPC5L; ARPC2; ARPC1B; ARPC4; ARPC5; PRKACA; LPP; CALU; CALR; VCAM1; ITGA4; FN1; WAS; ARPC1A; ACTR2; ACTR3; EZR; MAPK6; ARAP1; THNSL2; OTUD5; WASF2; EFTUD2; PRMT1; LGALS4; CDKN2B; LTA4H; BAG6; CETP; RPS4X
Blocking Peptide:
For anti-ARPC3 (ARP52092_P050) antibody is Catalog # AAP52092 (Previous Catalog # AAPP40321)
Datasheets/Manuals:
Printable datasheet for anti-ARPC3 (ARP52092_P050) antibody
Subunit:
3
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...