Catalog No: OPCA13474
Price: $0.00
SKU
OPCA13474
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ ARPC2 Recombinant Protein (Human) (OPCA13474)
Datasheets/Manuals | Printable datasheet for OPCA13474 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 1-300 |
Gene Full Name | actin related protein 2/3 complex subunit 2 |
---|---|
Alias Symbols | ARC34, PRO2446, p34-Arc, PNAS-139 |
NCBI Gene Id | 10109 |
Protein Name | actin-related protein 2/3 complex subunit 2 |
Description of Target | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by |
Uniprot ID | O15144 |
Protein Accession # | NP_005722.1 |
Nucleotide Accession # | NM_005731.3 |
Protein Size (# AA) | 300 |
Write Your Own Review