Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58587_P050-FITC Conjugated

ARP58587_P050-HRP Conjugated

ARP58587_P050-Biotin Conjugated

ARPC2 Antibody - N-terminal region (ARP58587_P050)

Catalog#: ARP58587_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100923 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-ARPC2 (ARP58587_P050)
Peptide Sequence Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ARPC2 (ARP58587_P050) antibody is Catalog # AAP58587 (Previous Catalog # AAPP35707)
Datasheets/Manuals Printable datasheet for anti-ARPC2 (ARP58587_P050) antibody
Subunit 2
Target Reference Cai,L., (2007) Cell 128 (5), 915-929

Al Ghouleh, I., Rodríguez, A., Pagano, P. J. & Csányi, G. Proteomic analysis identifies an NADPH oxidase 1 (Nox1)-mediated role for actin-related protein 2/3 complex subunit 2 (ARPC2) in promoting smooth muscle cell migration. Int. J. Mol. Sci. 14, 20220-35 (2013). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24152438

Gene Symbol ARPC2
Official Gene Full Name Actin related protein 2/3 complex, subunit 2, 34kDa
Alias Symbols ARC34, PNAS-139, PRO2446, p34-Arc
NCBI Gene Id 10109
Protein Name Actin-related protein 2/3 complex subunit 2
Description of Target ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.
Swissprot Id O15144
Protein Accession # NP_005722
Nucleotide Accession # NM_005731
Protein Size (# AA) 300
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ARPC2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ARPC2.
  1. What is the species homology for "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARPC2 Antibody - N-terminal region (ARP58587_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    This target may also be called "ARC34, PNAS-139, PRO2446, p34-Arc" in publications.

  5. What is the shipping cost for "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARPC2 Antibody - N-terminal region (ARP58587_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ARPC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARPC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARPC2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARPC2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARPC2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARPC2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARPC2 Antibody - N-terminal region (ARP58587_P050)
Your Rating
We found other products you might like!