Search Antibody, Protein, and ELISA Kit Solutions

ARPC2 antibody - N-terminal region (ARP58587_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58587_P050-FITC Conjugated

ARP58587_P050-HRP Conjugated

ARP58587_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Actin related protein 2/3 complex, subunit 2, 34kDa
Protein Name:
Actin-related protein 2/3 complex subunit 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ARC34, PNAS-139, PRO2446, p34-Arc
Replacement Item:
This antibody may replace item sc-100923 from Santa Cruz Biotechnology.
Description of Target:
ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARPC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARPC2.
The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ARPC2 (ARP58587_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ARPC2 (ARP58587_P050) antibody is Catalog # AAP58587 (Previous Catalog # AAPP35707)
Printable datasheet for anti-ARPC2 (ARP58587_P050) antibody
Target Reference:
Cai,L., (2007) Cell 128 (5), 915-929

Al Ghouleh, I., Rodríguez, A., Pagano, P. J. & Csányi, G. Proteomic analysis identifies an NADPH oxidase 1 (Nox1)-mediated role for actin-related protein 2/3 complex subunit 2 (ARPC2) in promoting smooth muscle cell migration. Int. J. Mol. Sci. 14, 20220-35 (2013). WB, Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24152438

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...