Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP30979_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30979_P050-FITC Conjugated

ARP30979_P050-HRP Conjugated

ARP30979_P050-Biotin Conjugated

Arnt Antibody - C-terminal region (ARP30979_P050)

Rating:
80% of 100
Catalog#: ARP30979_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17811 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-Arnt (ARP30979_P050)
Peptide Sequence Synthetic peptide located within the following region: SNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Arnt (ARP30979_P050) antibody is Catalog # AAP30979 (Previous Catalog # AAPS08305)
Datasheets/Manuals Printable datasheet for anti-Arnt (ARP30979_P050) antibody
Publications

Kurlak, LO; Mistry, HD; Cindrova-Davies, T; Burton, GJ; Broughton Pipkin, F; Human placental renin-angiotensin system in normotensive and pre-eclamptic pregnancies at high altitude and after acute hypoxia-reoxygenation insult. 594, 1327-40 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 26574162

Gene Symbol Arnt
Official Gene Full Name Aryl hydrocarbon receptor nuclear translocator
Alias Symbols Arnt1, Arnt
NCBI Gene Id 25242
Protein Name Aryl hydrocarbon receptor nuclear translocator
Description of Target Arnt is required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
Swissprot Id P41739
Protein Accession # NP_036912
Nucleotide Accession # NM_012780
Protein Size (# AA) 800
Molecular Weight 88kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Arnt.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Arnt.
Protein Interactions Ahr;
Write Your Own Review
You're reviewing:Arnt Antibody - C-terminal region (ARP30979_P050)
Your Rating