Catalog No: ARP55626_P050
Price: $0.00
SKU
ARP55626_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ARMC3 (ARP55626_P050) antibody
Product Info
ReferenceLi,X., (2006) Genetika 42 (7), 999-1003
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARMC3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-ARMC3 (ARP55626_P050) antibody is Catalog # AAP55626 (Previous Catalog # AAPP36003)
Gene SymbolARMC3
Gene Full NameArmadillo repeat containing 3
Alias SymbolsCT81, KU-CT-1
NCBI Gene Id219681
Protein NameArmadillo repeat-containing protein 3
Description of TargetThe specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831
Uniprot IDQ5W041
Protein Accession #NP_775104
Nucleotide Accession #NM_173081
Protein Size (# AA)872
Molecular Weight96kDa
  1. What is the species homology for "ARMC3 Antibody - middle region (ARP55626_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "ARMC3 Antibody - middle region (ARP55626_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARMC3 Antibody - middle region (ARP55626_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARMC3 Antibody - middle region (ARP55626_P050)"?

    This target may also be called "CT81, KU-CT-1" in publications.

  5. What is the shipping cost for "ARMC3 Antibody - middle region (ARP55626_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARMC3 Antibody - middle region (ARP55626_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARMC3 Antibody - middle region (ARP55626_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "96kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARMC3 Antibody - middle region (ARP55626_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ARMC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARMC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARMC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARMC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARMC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARMC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARMC3 Antibody - middle region (ARP55626_P050)
Your Rating