ARL4C Antibody - N-terminal region (ARP67007_P050)

Catalog No: ARP67007_P050

Host: Rabbit
Target Name: ARL4C
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARL4C
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGI
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP67007
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that ARL4C is expressed in HT1080

Target Info

• Gene Symbol: ARL4C
• Alias Symbols: LAK, ARL7
• NCBI Gene Id: 10123
• Protein Name: ADP-ribosylation factor-like protein 4C
• Description of Target: ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport.
• Uniprot ID: P56559
• Protein Accession #: NP_005728
• Nucleotide Accession #: NM_005737
• Protein Size (# AA): 192
• Molecular Weight: 21kDa
• Protein Interactions: UBC; APP; UBQLN4;