Size:100 ul
$319.00
In Stock
SKU
ARP52779_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52779_P050 Unconjugated

ARP52779_P050-FITC Conjugated

ARP52779_P050-HRP Conjugated

ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)

Catalog#: ARP52779_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-102316 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data Anti-ARL13B (ARP52779_P050)
Peptide Sequence Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Concentration 0.5 mg/ml
Blocking Peptide For anti-ARL13B (ARP52779_P050-Biotin) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738)
Datasheets/Manuals Printable datasheet for anti-ARL13B (ARP52779_P050-Biotin) antibody
Target Reference Fan,Y., (2004) Nat. Genet. 36 (9), 989-993
Publications

Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). WB, IHC, Human, Guinea pig, Bovine, Dog, Rabbit, Rat, Mouse, Horse, Zebrafish 21935430

Gene Symbol ARL13B
Official Gene Full Name ADP-ribosylation factor-like 13B
Alias Symbols ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8
NCBI Gene Id 200894
Protein Name Putative uncharacterized protein DKFZp761H079 EMBL CAD28544.2
Description of Target ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Swissprot Id Q8TCL5
Protein Accession # NP_659433
Nucleotide Accession # NM_144996
Protein Size (# AA) 428
Molecular Weight 48 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ARL13B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ARL13B.
Protein Interactions UBC;
  1. What is the species homology for "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    This target may also be called "ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8" in publications.

  5. What is the shipping cost for "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ARL13B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARL13B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARL13B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARL13B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARL13B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARL13B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)
Your Rating
We found other products you might like!