Search Antibody, Protein, and ELISA Kit Solutions

ARL13B Antibody - middle region : Biotin (ARP52779_P050-Biotin)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52779_P050 Unconjugated

ARP52779_P050-FITC Conjugated

ARP52779_P050-HRP Conjugated

Gene Symbol:
Official Gene Full Name:
ADP-ribosylation factor-like 13B
NCBI Gene Id:
Protein Name:
Putative uncharacterized protein DKFZp761H079 EMBL CAD28544.2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8
Replacement Item:
This antibody may replace item sc-102316 from Santa Cruz Biotechnology.
Description of Target:
ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Protein Size (# AA):
Molecular Weight:
48 kDa
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARL13B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARL13B.
The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-ARL13B (ARP52779_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ARL13B (ARP52779_P050-Biotin) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738)
Printable datasheet for anti-ARL13B (ARP52779_P050-Biotin) antibody
Target Reference:
Fan,Y., (2004) Nat. Genet. 36 (9), 989-993

Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). WB, IHC, Human, Guinea pig, Bovine, Dog, Rabbit, Rat, Mouse, Horse, Zebrafish 21935430

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...