Size:100 ul
$319.00
In stock
SKU
ARP52779_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52779_P050-FITC Conjugated

ARP52779_P050-HRP Conjugated

ARP52779_P050-Biotin Conjugated

ARL13B Antibody - middle region (ARP52779_P050)

Catalog#: ARP52779_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-102316 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARL13B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Complete computational species homology dataAnti-ARL13B (ARP52779_P050)
Peptide SequenceSynthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ARL13B (ARP52779_P050) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738)
Datasheets/ManualsPrintable datasheet for anti-ARL13B (ARP52779_P050) antibody
Target ReferenceFan,Y., (2004) Nat. Genet. 36 (9), 989-993
Publications

Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21935430

Gene SymbolARL13B
Official Gene Full NameADP-ribosylation factor-like 13B
Alias SymbolsARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8
NCBI Gene Id200894
Protein NamePutative uncharacterized protein DKFZp761H079 EMBL CAD28544.2
Description of TargetARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Swissprot IdQ8TCL5
Protein Accession #NP_659433
Nucleotide Accession #NM_144996
Protein Size (# AA)428
Molecular Weight48 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ARL13B.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ARL13B.
Protein InteractionsUBC;
Write Your Own Review
You're reviewing:ARL13B Antibody - middle region (ARP52779_P050)
Your Rating
Assay Development
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Blast Tool