Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ARL13B antibody - middle region (ARP52779_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP52779_P050-FITC Conjugated

ARP52779_P050-HRP Conjugated

ARP52779_P050-Biotin Conjugated

Gene Symbol:
ARL13B
NCBI Gene Id:
200894
Official Gene Full Name:
ADP-ribosylation factor-like 13B
Protein Name:
Putative uncharacterized protein DKFZp761H079 EMBL CAD28544.2
Swissprot Id:
Q8TCL5
Protein Accession #:
NP_659433
Nucleotide Accession #:
NM_144996
Alias Symbols:
ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8
Replacement Item:
This antibody may replace item sc-102316 from Santa Cruz Biotechnology.
Description of Target:
ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Protein Size (# AA):
428
Molecular Weight:
48 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARL13B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARL13B.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-ARL13B (ARP52779_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-ARL13B (ARP52779_P050) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738)
Datasheets/Manuals:
Printable datasheet for anti-ARL13B (ARP52779_P050) antibody
Target Reference:
Fan,Y., (2004) Nat. Genet. 36 (9), 989-993
Publications:

Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21935430

Tell us what you think about this item!

Write A Review
    Please, wait...