Search Antibody, Protein, and ELISA Kit Solutions

ARL13B Antibody - middle region (ARP52779_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52779_P050-FITC Conjugated

ARP52779_P050-HRP Conjugated

ARP52779_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-102316 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ARL13B
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-ARL13B (ARP52779_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ARL13B (ARP52779_P050) antibody is Catalog # AAP52779 (Previous Catalog # AAPP33738)
Datasheets/Manuals:
Printable datasheet for anti-ARL13B (ARP52779_P050) antibody
Target Reference:
Fan,Y., (2004) Nat. Genet. 36 (9), 989-993
Publications:

Zhang, Z. et al. Fuz regulates craniofacial development through tissue specific responses to signaling factors. PLoS One 6, e24608 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21935430

Gene Symbol:
ARL13B
Official Gene Full Name:
ADP-ribosylation factor-like 13B
Alias Symbols:
ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8
NCBI Gene Id:
200894
Protein Name:
Putative uncharacterized protein DKFZp761H079 EMBL CAD28544.2
Description of Target:
ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Swissprot Id:
Q8TCL5
Protein Accession #:
NP_659433
Nucleotide Accession #:
NM_144996
Protein Size (# AA):
428
Molecular Weight:
48 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARL13B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARL13B.
Protein Interactions:
UBC;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...