ARL11 Antibody - middle region (ARP52609_P050)

Catalog No: ARP52609_P050

WB Suggested Anti-ARL11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL11
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARL11 (ARP52609_P050) antibody is Catalog # AAP52609 (Previous Catalog # AAPY03688)

Target Info

• Reference: Siltanen,S., (er) Eur. J. Hum. Genet. (2008) In press
• Gene Symbol: ARL11
• Gene Full Name: ADP-ribosylation factor-like 11
• Alias Symbols: ARLTS1
• NCBI Gene Id: 115761
• Protein Name: ADP-ribosylation factor-like protein 11
• Description of Target: ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).
• Uniprot ID: Q969Q4
• Protein Accession #: NP_612459
• Nucleotide Accession #: NM_138450
• Protein Size (# AA): 196
• Molecular Weight: 21kDa
• Protein Interactions: TRIP13; UBC;