Search Antibody, Protein, and ELISA Kit Solutions

ARID5A Antibody - N-terminal region (ARP50911_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50911_P050-FITC Conjugated

ARP50911_P050-HRP Conjugated

ARP50911_P050-Biotin Conjugated

Gene Symbol:
ARID5A
Official Gene Full Name:
AT rich interactive domain 5A (MRF1-like)
NCBI Gene Id:
10865
Protein Name:
AT-rich interactive domain-containing protein 5A
Swissprot Id:
Q03989
Protein Accession #:
NP_997646
Nucleotide Accession #:
NM_212481
Alias Symbols:
MRF-1, RP11-363D14, MRF1
Replacement Item:
This antibody may replace item sc-137607 from Santa Cruz Biotechnology.
Description of Target:
Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth.Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 [PubMed 15640446]).[supplied by OMIM].
Protein Size (# AA):
594
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARID5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARID5A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ARID5A
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ARID5A (ARP50911_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LWKNVYDELGGSPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP12-4; KRTAP12-2; KRT40; RHOXF2; RBPMS; DAZAP2; SOX5; MDFI; GOLGA2; DAB1; CKS1B; PNMA1; ATXN1; UBC; UBD; THRA; RXRA; RARA; ESR2; ESR1; AR;
Blocking Peptide:
For anti-ARID5A (ARP50911_P050) antibody is Catalog # AAP50911 (Previous Catalog # AAPP29923)
Datasheets/Manuals:
Printable datasheet for anti-ARID5A (ARP50911_P050) antibody
Sample Type Confirmation:

ARID5A is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Lim,J., (2006) Cell 125 (4), 801-814

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...