Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38798_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38798_P050-FITC Conjugated

ARP38798_P050-HRP Conjugated

ARP38798_P050-Biotin Conjugated

ARID3B Antibody - C-terminal region (ARP38798_P050)

Catalog#: ARP38798_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101888 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-ARID3B (ARP38798_P050)
Peptide Sequence Synthetic peptide located within the following region: AQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWSL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ARID3B (ARP38798_P050) antibody is Catalog # AAP38798 (Previous Catalog # AAPP21007)
Datasheets/Manuals Printable datasheet for anti-ARID3B (ARP38798_P050) antibody
Sample Type Confirmation

ARID3B is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Kortschak,R.D., (2000) Trends Biochem. Sci. 25 (6), 294-299
Gene Symbol ARID3B
Official Gene Full Name AT rich interactive domain 3B (BRIGHT-like)
Alias Symbols BDP, DRIL2
NCBI Gene Id 10620
Protein Name AT-rich interactive domain-containing protein 3B
Description of Target ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Swissprot Id O95443
Protein Accession # NP_006456
Nucleotide Accession # NM_006465
Protein Size (# AA) 560
Molecular Weight 61kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ARID3B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ARID3B.
Protein Interactions SOX2; APP; TINF2; POT1; UBC; IRF9; MEPCE; CDK9; RB1;
  1. What is the species homology for "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ARID3B Antibody - C-terminal region (ARP38798_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    This target may also be called "BDP, DRIL2" in publications.

  5. What is the shipping cost for "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ARID3B Antibody - C-terminal region (ARP38798_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ARID3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ARID3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ARID3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ARID3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ARID3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ARID3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ARID3B Antibody - C-terminal region (ARP38798_P050)
Your Rating