Search Antibody, Protein, and ELISA Kit Solutions

ARID3B Antibody - C-terminal region (ARP38798_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38798_P050-FITC Conjugated

ARP38798_P050-HRP Conjugated

ARP38798_P050-Biotin Conjugated

Gene Symbol:
ARID3B
Official Gene Full Name:
AT rich interactive domain 3B (BRIGHT-like)
NCBI Gene Id:
10620
Protein Name:
AT-rich interactive domain-containing protein 3B
Swissprot Id:
O95443
Protein Accession #:
NP_006456
Nucleotide Accession #:
NM_006465
Alias Symbols:
BDP, DRIL2
Replacement Item:
This antibody may replace item sc-101888 from Santa Cruz Biotechnology.
Description of Target:
ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Protein Size (# AA):
560
Molecular Weight:
61kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ARID3B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ARID3B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3B
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-ARID3B (ARP38798_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWSL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SOX2; APP; TINF2; POT1; UBC; IRF9; MEPCE; CDK9; RB1;
Blocking Peptide:
For anti-ARID3B (ARP38798_P050) antibody is Catalog # AAP38798 (Previous Catalog # AAPP21007)
Datasheets/Manuals:
Printable datasheet for anti-ARID3B (ARP38798_P050) antibody
Sample Type Confirmation:

ARID3B is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Kortschak,R.D., (2000) Trends Biochem. Sci. 25 (6), 294-299

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...