ARHGEF7 Antibody - middle region (ARP96901_P050)

Catalog No: ARP96901_P050

Host: Rabbit
Target Name: ARHGEF7
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF7
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ARHGEF7 (ARP96901_P050) antibody is Catalog # AAP96901

Target Info

• Gene Symbol: ARHGEF7
• Gene Full Name: Rho guanine nucleotide exchange factor 7
• Alias Symbols: P50, P85, PAK3, PIXB, COOL1, P50BP, COOL-1, P85SPR, BETA-PIX, P85COOL1, Nbla10314
• NCBI Gene Id: 8874
• Protein Name: rho guanine nucleotide exchange factor 7
• Description of Target: This gene encodes a protein that belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene.
• Uniprot ID: Q14155-2
• Protein Accession #: NP_001106983.1
• Nucleotide Accession #: NM_001113511.1
• Protein Size (# AA): 753
• Molecular Weight: 82 kDa